PADB-logoLSSR - PepMap molecular information by study

Study ID UNPUBLISHED_1
Species human
Disease healthy, cancer
Tissue / Source urine
Compartment whole

Molecule IDGeneNameAcc. numberSequenceMassChargeIntensityScores and Counts
A8269IGHG2Ig gamma-2IGHG2_HUMAN-.ASTKGPSVFPLAPCSR.S  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMAN-.ASTKGPSVFPLAPSSK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.DIEMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.DIEMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.DIEMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV122_HUMAN-.DIQLTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTESPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTESPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTESPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTESPSSLSASVGNR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV101_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV107_HUMAN-.DIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV114_HUMAN-.DIQMTQSPSSLSASVGNR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV121_HUMAN-.DIQMTQSPSSLSATVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV121_HUMAN-.DIQMTQSPSSLSATVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV121_HUMAN-.DIQMTQSPSSLSATVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV121_HUMAN-.DIQMTQSPSSLSATVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV113_HUMAN-.DIQMTQSPSSLSVSVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMAN-.DIQMTQSPSTLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV402_HUMAN-.DIVMTQSPDSLAVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV405_HUMAN-.DIVMTQSPDSLVVSLGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV204_HUMAN-.DIVMTQSPLSLPVTPGEPASISCR.S  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV319_HUMAN-.DVQLVESGGGLVKPGGSLR.L  
A8273IGK, SDNK1, A30Ig kappa chainKV120_HUMAN-.DVQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV201_HUMAN-.EDIVMTQTPLSLPVTPGEPASISCR.S  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTESPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV305_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV304_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV302_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV307_HUMAN-.EIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.EIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV306_HUMAN-.EIVMTQSPVTLSVSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV306_HUMAN-.EIVMTQSPVTLSVSPGER.A  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV304_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV315_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV318_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV313_HUMAN-.EVQLLESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV305_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV316_HUMAN-.EVQLVESGGGLVQPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV306_HUMAN-.EVQLVETGGGLIQPGGSLR.L  
A4703COL9A2Collagen alpha 2(IX) chain precursorCO9A2_HUMAN-.MAAATASPR.S  
A887BCNNM3, ACDP3Metal transporter CNNM3CNNM3_HUMAN-.MAAAVAAAGR.L  
A4317ERP29, ERP28Endoplasmic reticulum resident protein 29ERP29_HUMAN-.MAAAVPR.A  
A093CLMAN2Vesicular integral-membrane protein VIP36 precursorLMAN2_HUMAN-.MAAEGWIWR.W  
A2241FBXL6, FBL6F-box/LRR-repeat protein 6FBXL6_HUMAN-.MAAPASR.Q  
A2241FBXL6, FBL6F-box/LRR-repeat protein 6FBXL6_HUMAN-.MAAPASRQVR.R  
A212BZCCHC4, HSPC052Zinc finger CCHC domain containing protein 4ZCHC4_HUMAN-.MAASR.N  
A0536S100A6, CACYCalcyclinS10A6_HUMAN-.MACPLDQAIGLLVAIFHK.Y  
A5981CATCatalaseCATA_HUMAN-.MADSR.D  
A7696RNF115, ZNF364Zinc finger protein 364ZN364_HUMAN-.MAEASAAGADSGAAVAAHR.F  
A9980pp52, LSP1, WP34Lymphocyte-specific protein 1LSP1_HUMAN-.MAEASSDPGAEER.E  
A8401CST3Cystatin C precursorCYTC_HUMAN-.MAGPLR.A  
A1013DSC1, CDHF1Desmocollin 1A/1B precursorDSC1_HUMAN-.MALASAAPGSIFCK.Q  
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_HUMAN-.MAPSR.K  
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_HUMAN-.MAPSR.K  
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_HUMAN-.MAPSR.K  
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_HUMAN-.MAPSR.K  
A1260ITSN2, SH3D1B, SWAPIntersectin 2ITSN2_HUMAN-.MAQFPTAMNGGPNMWAITSEER.T  
A4576ANXA5, ANX5, ENX2Annexin A5ANXA5_HUMAN-.MAQVLR.G  
A1930PVRL2, HVEB, PRR2Poliovirus receptor related protein 2 precursorPVRL2_HUMAN-.MARAAALLPSR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMAN-.MASTSTTIRSHSSSR.R  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMAN-.MASTSTTIRSHSSSR.R  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMAN-.MASTSTTIRSHSSSR.R  
A7364PGAM2, PGAMMPhosphoglycerate mutase 2PGAM2_HUMAN-.MATHRLVMVR.H  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMAN-.MCDDEETTALVCDNGSGLVK.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMAN-.MCDEDETTALVCDNGSGLVK.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMAN-.MCEEETTALVCDNGSGLCK.A  
A8273IGK, SDNK1, A30Ig kappa chainKV310_HUMAN-.MEAPAQLLFLLLLWLPDTTR.E  
A8273IGK, SDNK1, A30Ig kappa chainKV310_HUMAN-.MEAPAQLLFLLLLWLPDTTR.E  
A0324JUP, CTNNG, DP3Junction plakoglobinPLAK_HUMAN-.MEVMNLMEQPIK.V  
A3590OMG, OMGPOligodendrocyte-myelin glycoprotein precursorOMGP_HUMAN-.MEYQILK.M  
A1780MMP8, CLG1Neutrophil collagenase precursorMMP8_HUMAN-.MFSLKTLPFLLLLHVQISK.A  
A1467FGAFibrinogen alpha/alpha-E chain precursorFIBA_HUMAN-.MFSMR.I  
A7185NSUN5, WBSCR20, WBSCR20APutative Methyltransferase NSUN5NSUN5_HUMAN-.MGLYAAAAGVLAGVESR.Q  
A6423ENDOD1Endonuclease domain-containing 1 protein precursorENDD1_HUMAN-.MGTAR.W  
A9503TNFRSF21, DR6, UNQ437/PRO868Tumor necrosis factor receptor superfamily member 21 precursorTNR21_HUMAN-.MGTSPSSSTALASCSRIAR.R  
A9936MST1, D3F15S2, DNF15S2Hepatocyte growth factor-like protein precursorHGFL_HUMAN-.MGWLPLLLLLTQCLGVPGQR.S  
A0840RHPN1Rhophilin 1RHPN1_HUMAN-.MILEERPDGAGAGEESPR.L  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMAN-.MKLITILFLCSR.L  
A054CKIF21A, KIF2, NY-REN-62Kinesin family member 21AKI21A_HUMAN-.MLGAPDESSVRVAVR.I  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEK.A  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMAN-.MLTELEKALNSIIDVYHK.Y  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMAN-.MMCGAPSATQPATAETQHIADQVRSQLEEK.E  
A2343ACTN3Alpha-actinin 3ACTN3_HUMAN-.MMMVMQPEGLGAGEGR.F  
A2343ACTN3Alpha-actinin 3ACTN3_HUMAN-.MMMVMQPEGLGAGEGR.F  
A1110EPS8Epidermal growth factor receptor kinase substrate 8EPS8_HUMAN-.MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDR.E  
A499AHIST1H2BC, HIST1H2BE, HIST1H2BFHistone H2B.a/g/h/kH2B1C_HUMAN-.MPEPAKSAPAPK.K  
A503AHIST1H2BJ, H2BFRHistone H2B type 1-JH2B1J_HUMAN-.MPEPAKSAPAPK.K  
A504AHIST1H2BC, HIST1H2BK, H2BFTHistone H2B KH2B1K_HUMAN-.MPEPAKSAPAPK.K  
A513AHIST2H2BE, H2BFQ, H2B.1Histone H2B type 2-EH2B2E_HUMAN-.MPEPAKSAPAPK.K  
A517AH2BFSHistone H2B type F-SH2BFS_HUMAN-.MPEPAKSAPAPK.K  
A5923GLB1, ELNR1Beta-galactosidase precursorBGAM_HUMAN-.MPGFLVR.I  
A5923GLB1, ELNR1Beta-galactosidase precursorBGAL_HUMAN-.MPGFLVR.I  
A795CANKRD42Ankyrin repeat domain-containing protein 42ANR42_HUMAN-.MPGVANSGPSTSSR.E  
A5583PRICKLE1, RILPPrickle-like protein 1PRIC1_HUMAN-.MPLEMEPKMSK.L  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMAN-.MPPYTVVYFPVR.G  
A5404NAV3, POMFIL1, STEERIN3Neuron navigator 3NAV3_HUMAN-.MPVLGVASK.L  
A8807GCHFR, GFRPGTP cyclohydrolase 1 feedback regulatory proteinGFRP_HUMAN-.MPYLLISTQIR.M  
A236BZNF277, NRIF4, ZNF277PZinc finger protein 277ZN277_HUMAN-.MQEDR.D  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1256UBBPolyubiquitin-BUBIQ_HUMAN-.MQIFVKTLTGK.T  
A1410COL6A1Collagen alpha 1(VI) chain precursorCO6A1_HUMAN-.MRAAR.A  
A1001DNASE1, DNL1, DRNIDeoxyribonuclease 1DNAS1_HUMAN-.MRGMK.L  
A4880KRT79, K6L, KB38Keratin, type II cytoskeletal 79K2C79_HUMAN-.MRSSVSR.Q  
A4880KRT79, K6L, KB38Keratin, type II cytoskeletal 79K2C79_HUMAN-.MRSSVSR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMAN-.MSCQISCK.S  
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMAN-.MSCRQFSSSYLSR.S  
A3825KRT24, KA24Keratin, type I cytoskeletal 24K1C24_HUMAN-.MSCSSRASSSR.A  
A9775ARL15, ARFRP2ARFRP2 proteinARL15_HUMAN-.MSDLR.I  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMAN-.MSETAPAAPAAAPPAEKAPVK.K  
A166D Protein C14orf93 precursorCN093_HUMAN-.MSFSATILFSPPSGSEARCCCCACK.S  
A226DPNAS-11, RIP5, PNAS-23Protein C20orf24CT024_HUMAN-.MSGGR.R  
A9050SH3BGRL3, P1725SH3 domain-binding glutamic acid-rich-like protein 3SH3L3_HUMAN-.MSGLR.V  
A1028HIST1H2AC, H2AFLHistone H2A.lH2A1C_HUMAN-.MSGRGK.Q  
A477AHIST1H2AG, H2AFP, HIST1H2AIHistone H2A type 1H2A1_HUMAN-.MSGRGK.Q  
A478AHIST1H2AA, H2AFRHistone H2A type 1-AH2A1A_HUMAN-.MSGRGK.Q  
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.aH2A1B_HUMAN-.MSGRGK.Q  
A479AHIST1H2AB, HIST1H2AE, H2AFMHistone H2A.aH2A1E_HUMAN-.MSGRGK.Q  
A480AHIST1H2AD, H2AFGHistone H2A.gH2A1D_HUMAN-.MSGRGK.Q  
A482AHIST1H2AH, HIST1H2AIHistone H2A type 1-HH2A1H_HUMAN-.MSGRGK.Q  
A483AHIST1H2AJ, H2AFE, HIST1H2AKH2A/eH2A1J_HUMAN-.MSGRGK.Q  
A485AHIST2H2AA3, H2AFO, HIST2H2AAHistone H2A.oH2A2A_HUMAN-.MSGRGK.Q  
A486AHIST2H2ABHistone H2A type 2-BH2A2B_HUMAN-.MSGRGK.Q  
A487AHIST2H2AC, H2AFQHistone H2A type 7H2A2C_HUMAN-.MSGRGK.Q  
A488AHIST3H2AH2A histone family, member LH2A3_HUMAN-.MSGRGK.Q  
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMAN-.MSGRGK.Q  
A4876KRT77, KRT1BKeratin 77K2C1B_HUMAN-.MSHQFSSQSAFSSMSRR.V  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMAN-.MSILK.I  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENO1B_HUMAN-.MSILK.I  
A3786GUCA1B, KRT13Keratin, type I cytoskeletal 13K1C13_HUMAN-.MSLRLQSSSASYGGGFGGGSCQLGGGR.G  
A5980CASP14Caspase-14 precursorCASPE_HUMAN-.MSNPR.S  
A9974LGALS7, PIG1, LGALS7BGalectin-7LEG7_HUMAN-.MSNVPHK.S  
A5067PCDH8Protocadherin 8 precursorPCDH8_HUMAN-.MSPVR.R  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMAN-.MSRQFSSR.S  
A2084ATG16L1, APG16L, UNQ9393/PRO34307Autophagy protein 16-likeA16L1_HUMAN-.MSSGLRAADFPR.W  
A8170UK114, HRSP12, PSPRibonuclease UK114UK114_HUMAN-.MSSLIR.R  
A1308BLMHBleomycin hydrolaseBLMH_HUMAN-.MSSSGLNSEK.V  
A768BABCA5ATP-binding cassette, sub-family A , member 5ABCA5_HUMAN-.MSTAIREVGVWR.Q  
A3826KRT25C, KRT27Keratin, type I cytoskeletal 27K1C27_HUMAN-.MSVRFSSTSR.R  
A1551S100A9, CAGB, CFAGProtein S100-A9S10A9_HUMAN-.MTCKMSQLER.N  
A1741HBA1, HBA2, HBZHemoglobin subunit alphaHBA_HUMAN-.MVLSPADKTNVK.A  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMAN-.MYSNVIGTVTSGK.R  
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMAN-.MYSSSSCKLPSLSPVAR.S  
A3832KRT35, KRTHA5, HKA5Keratin, type I cuticular Ha5KRT35_HUMAN-.MYSSSSCKLPSLSPVAR.S  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIEMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV105_HUMAN-.NIQMTQSPSSLSASVGDR.V  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTESPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTESPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGER.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV301_HUMAN-.QIVLTQSPGTLSLSPGQR.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMAN-.QPKAAPSVTLFPPSSEELQANK.A  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV310_HUMAN-.QVKLVQAGGGVVQPGR.S  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV310_HUMAN-.QVKLVQAGGGVVQPGR.S  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV310_HUMAN-.QVKLVQAGGGVVQPGR.S  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV310_HUMAN-.QVKLVQAGGGVVQPGR.S  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV310_HUMAN-.QVKLVQAGGGVVQPGR.S  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV106_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV106_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV101_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV101_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV101_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV101_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV101_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV107_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV107_HUMAN-.QVQLVQSGAEVK.K  
A8229IgG VH, IGHV7-81, IGHV1Ig heavy chain V-I regionHV107_HUMAN-.QVQLVQSGAEVK.K  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8243IGH, HuVH8B VH, scFvIg heavy chain V-III regionHV301_HUMAN-.QVQLVQSGGGLVKPGGSLR.L  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV301_HUMAN-.SELTQDPAVSVALGQTVR.I  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV403_HUMAN-.SYELTQPPSVSVSPGQTAR.I  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMAN-.TVAAPSVFIFPPSDEQLK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV303_HUMAN-.VPSGEIVLTQSPGTLSLSPGERATLSCR.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV302_HUMAN-.YVLTQPPSVSVAPGETAR.L  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV302_HUMAN-.YVLTQPPSVSVAPGETAR.L  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV302_HUMAN-.YVLTQPPSVSVAPGETAR.L  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLV302_HUMAN-.YVLTQPPSVSVAPGETAR.L  
A2019KDM5A, JARID1A, RBBP2Lysine-specific demethylase 5AJAD1A_HUMANK.AAAAK.V  
A2019KDM5A, JARID1A, RBBP2Lysine-specific demethylase 5AJAD1A_HUMANK.AAAAKVELVK.E  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_HUMANK.AAAQR.K  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_HUMANK.AAAQRK.A  
A8016TPP1, CLN2, GIG1Tripeptidyl-peptidase I precursorTPP1_HUMANK.AAARGLTLLFASGDSGAGCWSVSGR.H  
A2407COL12A1, COL12A1LCollagen alpha 1(XII) chain precursorCOCA1_HUMANK.AADAK.E  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.AADDTWEPFASGK.T  
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16S10AG_HUMANK.AADKLIQNLDANHDGR.I  
A9788BCL9B-cell lymphoma 9 proteinBCL9_HUMANK.AAEAVLK.G  
A7008MTR5-methyltetrahydrofolate-homocysteine methyltransferaseMETH_HUMANK.AAEEVTLQTGIK.R  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGR.G  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q  
A6759HUWE1, UREB1, HSPC272E3 ubiquitin-protein ligase HUWE1HUWE1_HUMANK.AAFTCIK.N  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AAFTECCQAADKAACLLPK.L  
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_HUMANK.AAGAGKVTK.S  
A4815FLNC, ABPL, FLN2Filamin CFLNC_HUMANK.AAGEGK.V  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.AAGGATPK.K  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.AAGKGK.L  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.AAGSR.A  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.AAGSR.A  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.AAGSR.A  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.AAGSR.A  
A6333DIS3L, DIS3L1DIS3-like exonuclease 1DI3L1_HUMANK.AAHELCDSILQSR.R  
A160CMYH15Myosin-15MYH15_HUMANK.AAIEAANLSEELKK.K  
A3962MYH14, FP17425Myosin-14MYH14_HUMANK.AAILEEKR.Q  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.AAIVEKLSSLPFQK.I  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.AAKPKSGKPK.V  
A7368HPGD, PGDH, PGDH115-hydroxyprostaglandin dehydrogenase [NAD(+)]PGDH_HUMANK.AALDEQFEPQK.T  
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.AALEK.S  
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.AALEK.S  
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.AALEK.S  
A3829KRT9Keratin, type I cytoskeletal 9K1C9_HUMANK.AALEKSLEDTK.N  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AALKTASDFITK.M  
A6759HUWE1, UREB1, HSPC272E3 ubiquitin-protein ligase HUWE1HUWE1_HUMANK.AALPLTTSDTKTVSEWISQMATLPQASNLATR.I  
A0324JUP, CTNNG, DP3Junction plakoglobinPLAK_HUMANK.AAMIVNQLSK.K  
A744DNCKAP5, ERIH, NAP5Nck-associated protein 5NAP5_HUMANK.AAPQTESGSSNASCRNVLK.G  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AAPSVTLFPPSSEELQANK.A  
A8404CST6Cystatin M precursorCYTM_HUMANK.AAQAAVASYNMGSNSIYYFR.D  
A8404CST6Cystatin M precursorCYTM_HUMANK.AAQAAVASYNMGSNSIYYFR.D  
A7947TALH, TALDO1, TALTransaldolaseTALDO_HUMANK.AAQASDLEKIHLDEK.S  
A4575ANXA4, PIG28, ANX4Annexin A4ANXA4_HUMANK.AASGFNAMEDAQTLR.K  
A901ARAI1Retinoid-acid induced protein 1RAI1_HUMANK.AASSPSNPAALPVASDSSPMGSK.T  
A964CCCDC132Coiled-coil domain-containing protein 132CC132_HUMANK.AASTFK.H  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.AATGECTATVGK.R  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.AATGECTATVGKR.S  
A4060ASPM, MCPH5Abnormal spindlesASPM_HUMANK.AAVIIQTHFR.A  
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.AAVLTLAVLFLTGSQAR.H  
A0742TTNTitinTITIN_HUMANK.AAWYTIDSRVR.G  
A0647ANXA1, ANX1, LPC1Annexin A1ANXA1_HUMANK.AAYLQETGKPLDETLKK.A  
A0647ANXA1, ANX1, LPC1Annexin A1ANXA1_HUMANK.AAYLQETGKPLDETLKK.A  
A0542EPHB1, ELK, EPHT2Ephrin type-B receptor 1 precursorEPHB1_HUMANK.ACPAGTFKASQEAEGCSHCPSNSR.S  
A0742TTNTitinTITIN_HUMANK.ADAPVK.W  
A1923ALDOA, ALDAFructose-bisphosphate aldolase AALDOA_HUMANK.ADDGRPFPQVIK.S  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.ADEDPIMGFHQMFLLK.N  
A0210NUTF2, NTF2, PP15Nuclear transport factor 2NTF2_HUMANK.ADEDPIMGFHQMFLLK.N  
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_HUMANK.ADEGISFR.G  
A5959CA1Carbonic anhydrase 1CAH1_HUMANK.ADGLAVIGVLMK.V  
A5959CA1Carbonic anhydrase 1CAH1_HUMANK.ADGLAVIGVLMK.V  
A0742TTNTitinTITIN_HUMANK.ADGLR.R  
A0742TTNTitinTITIN_HUMANK.ADGLR.R  
A8720C4A, CO4, CPAMD2Complement C4 precursorCO4A_HUMANK.ADGSYAAWLSR.D  
A8720C4A, CO4, CPAMD2Complement C4 precursorCO4A_HUMANK.ADGSYAAWLSR.D  
A8721C4B, C4B12, C4B-1Complement C4-B precursorCO4B_HUMANK.ADGSYAAWLSR.D  
A8721C4B, C4B12, C4B-1Complement C4-B precursorCO4B_HUMANK.ADGSYAAWLSR.D  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKAHNK_HUMANK.ADIEISGPK.V  
A1598C3, CPAMD1Complement C3 precursorCO3_HUMANK.ADIGCTPGSGK.D  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ADIVFLLDGSINFR.R  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ADIVFLLDGSINFR.R  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ADIVFLLDGSINFR.R  
A1095HMGB1, HMG1, FM1High mobility group protein B1HMG1X_HUMANK.ADKAHYER.E  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLK.K  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.ADLEMQIESLTEELAYLKK.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGAR.N  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGARNLAVSQVVHK.A  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGARNLAVSQVVHK.A  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGARNLAVSQVVHK.A  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.ADLSGITGARNLAVSQVVHK.A  
A8420SERPINB1, ELANH2, MNEILeukocyte elastase inhibitorILEU_HUMANK.ADLSGMSGAR.D  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ADSSPVKAGVETTTPSK.Q  
A448AFYCO1, ZFYVE7FYVE and coiled-coil domain containing 1FYCO1_HUMANK.ADTASDTK.G  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.ADTLTDEINFLR.A  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.ADTLTDEINFLR.A  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.ADTLTDEINFLR.A  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.ADTLTDEINFLR.A  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.ADTLTDEINFLR.A  
A5981CATCatalaseCATA_HUMANK.ADVLTTGAGNPVGDK.L  
A5981CATCatalaseCATA_HUMANK.ADVLTTGAGNPVGDKLNVITVGPR.G  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  
A8273IGK, SDNK1, A30Ig kappa chainKAC_HUMANK.ADYEK.H  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.AEAEALYQTK.F  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.AEAEALYQTK.F  
A4878KRT73, K6IRS3, KB36Keratin, type II cytoskeletal 73K2C73_HUMANK.AEAEALYQTK.F  
A4878KRT73, K6IRS3, KB36Keratin, type II cytoskeletal 73K2C73_HUMANK.AEAEALYQTK.F  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.AEAEALYQTK.I  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.AEAEALYQTK.I  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.AEAEALYQTK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.AEAEALYQTK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.AEAEALYQTK.L  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.AEAEALYQTK.V  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.AEAEALYQTK.V  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.AEAEALYQTK.V  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.AEAEALYQTK.Y  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.AEAEALYQTK.Y  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.AEAEALYQTKFQELQLAAGR.H  
A4878KRT73, K6IRS3, KB36Keratin, type II cytoskeletal 73K2C73_HUMANK.AEAEALYQTKFQELQLAAGR.H  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.AEAEALYQTKLGELQTTAGR.H  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.AEAEALYQTKLGELQTTAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSK.Y  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.AEAESLYQSKYEELQITAGR.H  
A5152HSpTB1, SPTB, SPTB1Spectrin beta chain, erythrocyteSPTB1_HUMANK.AEAIQNKEQEVSAAWQALLDACAGR.R  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AEAQAQYSAAVAK.G  
A435AFOXK2, ILF, ILF1Interleukin enhancer-binding factor 1FOXK2_HUMANK.AEAQENGDHREVK.V  
A2009HSPA6, HSP70B'Heat shock 70 kDa protein 6HSP76_HUMANK.AEDEAQRDR.V  
A4999MYBPC1, MYBPCSMyosin-binding protein C, slow-typeMYPC1_HUMANK.AEDLLRKPTIK.W  
A5999CPB1, CPB, PCPBCarboxypeptidase B precursorCBPB1_HUMANK.AEDTVTVENVLK.Q  
A6042CPCeruloplasmin precursorCERU_HUMANK.AEEEHLGILGPQLHADVGDKVK.I  
A518DGSE1Genetic suppressor element 1GSE1_HUMANK.AEEGPR.K  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSK.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSKLVTDLTK.V  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AEFAEVSKLVTDLTK.V  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.AEFLLNAHSSK.D  
A0454DSPDesmoplakinDESP_HUMANK.AEFQEEAKR.R  
A0454DSPDesmoplakinDESP_HUMANK.AEFQEEAKR.R  
A0454DSPDesmoplakinDESP_HUMANK.AEFQEEAKR.R  
A0454DSPDesmoplakinDESP_HUMANK.AEFQEEAKR.R  
A0742TTNTitinTITIN_HUMANK.AEGGK.R  
A0742TTNTitinTITIN_HUMANK.AEGGK.R  
A0742TTNTitinTITIN_HUMANK.AEGILTDR.A  
A7224OBSCNObscurinOBSCN_HUMANK.AEGVHTSAR.L  
A059CKIF14Kinesin-like protein KIF14KIF14_HUMANK.AEIAK.L  
A4814FLNB, FLN3, TAPFilamin-BFLNB_HUMANK.AEISCIDNKDGTCTVTYLPTLPGDYSILVK.Y  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.AEISFEDR.K  
A575BPRRT3, UNQ5823/PRO19642, UNQ5823Proline-rich transmembrane protein 3 precursorPRRT3_HUMANK.AELDDAGSSLLR.G  
A575BPRRT3, UNQ5823/PRO19642, UNQ5823Proline-rich transmembrane protein 3 precursorPRRT3_HUMANK.AELDDAGSSLLRGR.C  
A5462SKTSickle tail protein homologSKT_HUMANK.AELEISGK.V  
A4660CEP290, BBS14, NPHP6Centrosomal protein of 290 kDaCE290_HUMANK.AELEK.L  
A3837KRT32, HHA2, HKA2Keratin, type I cuticular Ha2K1H2_HUMANK.AENARMVVNIDNAK.L  
A186BZNF512B, GM632Zinc finger protein 512BZ512B_HUMANK.AENQALR.D  
A0742TTNTitinTITIN_HUMANK.AENSIGTASSK.T  
A0742TTNTitinTITIN_HUMANK.AENSIGTASSK.T  
A0742TTNTitinTITIN_HUMANK.AEPANAGKYICQIK.N  
A1628C9Complement component C9 precursorCO9_HUMANK.AEQCCEETASSISLHGK.G  
A174CMYO1FMyosin IfMYO1F_HUMANK.AEQEEYVQEGIR.W  
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidasePSA_HUMANK.AEQGK.F  
A242BZNF407Zinc finger protein 407ZN407_HUMANK.AESSSALHMHIK.Q  
A242BZNF407Zinc finger protein 407ZN407_HUMANK.AESSSALHMHIK.Q  
A0844ARHGEF1Rho guanine nucleotide exchange factor 1ARHG1_HUMANK.AEVDAEKPGATDR.K  
A4091CLASP1, MAST1CLIP-associating protein 1CLAP1_HUMANK.AFDDVPVVQIYSSR.D  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.AFGPGLQGGSAGSPAR.F  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.AFGPGLQGGSAGSPARFTIDTK.G  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AFITNFSMNIDGMTYPGIIKEK.A  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.AFLASPEYVNLPINGNGKQ.-  
A5167SYNE1, MYNE1Nesprin 1SYNE1_HUMANK.AFQQEISLNHNK.I  
A8683ATRN, MGCAAttractin precursorATRN_HUMANK.AFSANK.Y  
A5282CALML5, CLSPCalmodulin-like protein 5CALL5_HUMANK.AFSAVDTDGNGTINAQELGAALK.A  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMHS71L_HUMANK.AFYPEEISSMVLTK.L  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.AFYPEEISSMVLTK.M  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.AFYPEEISSMVLTK.M  
A3616ENO2Gamma enolaseENOG_HUMANK.AGAAERELPLYR.H  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.AGAAK.A  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.AGAAKPRKPAGAAK.K  
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.AGAHLQGGAKR.V  
A0331GAPD, GAPDHGlyceraldehyde 3-phosphate dehydrogenaseG3P_HUMANK.AGAHLQGGAKR.V  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGALNSNDAFVLK.T  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.AGAVEK.G  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.AGAVEKGVPLYR.H  
A1598C3, CPAMD1Complement C3 precursorCO3_HUMANK.AGDFLEANYMNLQR.S  
A9894DVL3, RACK8Segment polarity protein dishevelled homolog DVL-3DVL3_HUMANK.AGDSK.S  
A4565ALMS1Alstrom syndrome protein 1ALMS1_HUMANK.AGDTSK.G  
A0742TTNTitinTITIN_HUMANK.AGEPVHIPADVTGLPMPK.I  
A0742TTNTitinTITIN_HUMANK.AGEVLK.I  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4547ACTA2, ACTSA, ACTVSActin, aortic smooth muscleACTA_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1ACTB_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4551ACTC1, ACTCActin, alpha cardiac muscle 1ACTC_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4552ACTG1, ACTGActin, cytoplasmic 2ACTG_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4553ACTG2, ACTA3, ACTL3Actin, gamma 2 propeptideACTH_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A4555ACTA1, ACTAActin, alpha skeletal muscleACTS_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.AGFAGDDAPR.A  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A8434ITIH4, IHRP, ITIHL1Inter-alpha-trypsin inhibitor heavy chain H4 precursorITIH4_HUMANK.AGFSWIEVTFK.N  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.AGGPPK.K  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.AGGTPR.K  
A7693SCPEP1, RISC, SCP1Retinoid-inducible serine carboxypeptidase precursorRISC_HUMANK.AGHMVPSDQGDMALK.M  
A0742TTNTitinTITIN_HUMANK.AGHNQCSGHLTVK.E  
A6477FBP1, FBPFructose-1,6-bisphosphatase 1F16P1_HUMANK.AGIAHLYGIAGSTNVTGDQVK.K  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGKEPGLQIWR.V  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGKEPGLQIWR.V  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.AGKEPGLQIWR.V  
A8129USP51Ubiquitin carboxyl-terminal hydrolase 51UBP51_HUMANK.AGKMEEAAAGATK.A  
A3785KRT15, KRTBKeratin, type I cytoskeletal 15K1C15_HUMANK.AGLENSLAETECR.Y  
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50NHERF_HUMANK.AGLLAGDRLVEVNGENVEK.E  
A0806SLC9A3R1, NHERF, NHERF1Ezrin-radixin-moesin binding phosphoprotein-50NHERF_HUMANK.AGLLAGDRLVEVNGENVEK.E  
A283ESH3TC1SH3 domain and tetratricopeptide repeat-containing protein 1S3TC1_HUMANK.AGLLMALARLCFLLGR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AGLSSGFIGCVR.E  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AGLSSGFIGCVRELR.I  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AGLSSGFIGCVRELR.I  
A1575DST, BPAG1, DMHDystoninBPAEA_HUMANK.AGNDLIESSAGEEASNLQNK.L  
A0742TTNTitinTITIN_HUMANK.AGPGKPSDASK.A  
A8273IGK, SDNK1, A30Ig kappa chainKV201_HUMANK.AGQSPQLLIYTLSYR.A  
A8273IGK, SDNK1, A30Ig kappa chainKV201_HUMANK.AGQSPQLLIYTLSYR.A  
A3873ANK2Ankyrin 2ANK2_HUMANK.AGSIK.V  
A0742TTNTitinTITIN_HUMANK.AGTER.W  
A0742TTNTitinTITIN_HUMANK.AGTKIELPATVTGKPEPK.I  
A4815FLNC, ABPL, FLN2Filamin CFLNC_HUMANK.AGTNMMMVGVHGPK.T  
A2344ACTN4Alpha-actinin 4ACTN4_HUMANK.AGTQIENIDEDFR.D  
A5404NAV3, POMFIL1, STEERIN3Neuron navigator 3NAV3_HUMANK.AGTSALK.T  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.AGVETTTPSK.Q  
A0742TTNTitinTITIN_HUMANK.AGVGEHADVPGPIIVEEK.L  
A210BZC3H18, NHN1Zinc finger CCCH domain-containing protein 18ZCH18_HUMANK.AGVQSVGEK.E  
A8653ALS2, ALS2CR6AlsinALS2_HUMANK.AGYGVFDDITRGEK.Y  
A5802AMY1B, AMY1A, AMY1Alpha-amylase 1B, salivary precursorAMY1_HUMANK.AHFSISNSAEDPFIAIHAESK.L  
A5803AMY2BAlpha-amylase 2B precursorAMY2B_HUMANK.AHFSISNSAEDPFIAIHAESK.L  
A5805AMY2A, AMY2BAlpha-amylase 2A, pancreatic precursorAMYP_HUMANK.AHFSISNSAEDPFIAIHAESK.L  
A1493FGBFibrinogen beta chain precursorFIBB_HUMANK.AHYGGFTVQNEANKYQISVNK.Y  
A5520ZWINTZW10 interactorZWINT_HUMANK.AIAAK.E  
A467BGBP7, GBP4L, GBP2Guanylate-binding protein 7GBP7_HUMANK.AIAAK.Q  
A5832ASAH2, HNAC1Neutral ceramidaseASAH2_HUMANK.AIATDTVANLSR.G  
A098ARICTORRapamycin insensitive companion of MTORRICTR_HUMANK.AIATHQKR.D  
A0097TLN1, TLNTalin 1TLN1_HUMANK.AIAVTVQEMVTK.S  
A0454DSPDesmoplakinDESP_HUMANK.AIEDK.S  
A3617ENO3Beta enolaseENOB_HUMANK.AIFAGR.K  
A1177A2M, CPAMD5, FWP007Alpha-2-macroglobulin precursorA2MG_HUMANK.AIGYLNTGYQR.Q  
A7367CPQ, PGCP, LCH1Blood plasma glutamate carboxypeptidase precursorPGCP_HUMANK.AIINLAVYGK.A  
A376ETBC1D23, NS4ATP1TBC1 domain family member 23TBC23_HUMANK.AIKQQIMK.V  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorDSC2_HUMANK.AINDTAAR.L  
A4751DSC2, CDHF2, DSC3Desmocollin 2A/2B precursorDSC2_HUMANK.AINDTAARLSYQNDPPFGSYVVPITVR.D  
A8720C4A, CO4, CPAMD2Complement C4 precursorCO4A_HUMANK.AINEKLGQYASPTAK.R  
A8721C4B, C4B12, C4B-1Complement C4-B precursorCO4B_HUMANK.AINEKLGQYASPTAK.R  
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.AINKK.E  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_HUMANK.AINVQEEKIAALQAFADQLIAAGHYAK.G  
A0742TTNTitinTITIN_HUMANK.AIPKK.K  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSR.G  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.AIPVAQDLNAPSDWDSRGK.D  
A0454DSPDesmoplakinDESP_HUMANK.AISVPR.V  
A0454DSPDesmoplakinDESP_HUMANK.AITGFDDPFSGK.T  
A4857IGFBP7, MAC25, PSFInsulin-like growth factor binding protein 7 precursorIBP7_HUMANK.AITQVSKGTCEQGPSIVTPPK.D  
A3827KRT25, KRT25AKeratin, type I cytoskeletal 25K1C25_HUMANK.AIVVK.K  
A3827KRT25, KRT25AKeratin, type I cytoskeletal 25K1C25_HUMANK.AIVVK.K  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKAHNK_HUMANK.AKAPK.V  
A448AFYCO1, ZFYVE7FYVE and coiled-coil domain containing 1FYCO1_HUMANK.AKEAMK.A  
A0742TTNTitinTITIN_HUMANK.AKEQETILR.T  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AKHDELTYF.-  
A4258UBN1, VTUbinuclein-1UBN1_HUMANK.AKHHSLPR.T  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMHS71L_HUMANK.AKIHDIVLVGGSTR.I  
A2162SFRS18, PNISR, SRRP130Splicing factor, arginine/serine-rich 18SFR18_HUMANK.AKKPK.H  
A7668ADARB1, hRED1, ADAR2dRNA-specific adenosine deaminase B1RED1_HUMANK.AKLHAAEK.A  
A0742TTNTitinTITIN_HUMANK.AKNVAGER.S  
A0742TTNTitinTITIN_HUMANK.AKNVAGER.S  
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.AKPALEDLR.Q  
A0108MAGI2, ACVRINP1, AIP1Membrane-associated guanylate kinase, WW and PDZ domain containing protein 2MAGI2_HUMANK.AKPPEECK.E  
A2429IQSEC2, BRAG1IQ motif and SEC7 domain-containing protein 2IQEC2_HUMANK.AKPSR.I  
A5155SPTBN5, SPTBN4, BSPECVSpectrin beta chain, brain 4SPTN5_HUMANK.AKPVSSLNECTTK.D  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AKQDLAR.L  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AKQDLAR.L  
A1260ITSN2, SH3D1B, SWAPIntersectin 2ITSN2_HUMANK.AKQGK.E  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.AKSPK.K  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.AKSPK.K  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.AKSPK.K  
A2041CHD7Chromodomain-helicase-DNA-binding protein 7CHD7_HUMANK.AKTATPKPK.S  
A6254DCXR, KIDCRL-xylulose reductaseDCXR_HUMANK.AKTMLNR.I  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.AKVNMPAKPAPPTK.A  
A790BDBIAcyl-CoA-binding proteinACBP_HUMANK.AKWDAWNELK.G  
A790BDBIAcyl-CoA-binding proteinACBP_HUMANK.AKWDAWNELK.G  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AKWEMPFDPQDTHQSR.F  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AKWEMPFDPQDTHQSR.F  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AKWEMPFDPQDTHQSR.F  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AKWETSFNHK.G  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AKWETSFNHK.G  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AKWETSFNHK.G  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.ALAAAGYDVEKNNSR.I  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.ALAAAGYDVEKNNSR.I  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.ALAAAGYDVEKNNSR.I  
A0230ARPC5, ARC16ARP2/3 complex 16 kDa subunitARPC5_HUMANK.ALAAGGVGSIVR.V  
A9128TTI1, SMG10, Tti1Hypothetical proteinK0406_HUMANK.ALADILSESLHSLATSLPR.L  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_HUMANK.ALAVEGK.R  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_HUMANK.ALCAEADRLQQSHPLSATQIQVK.R  
A2408KMT2D, MLL2, ALRHistone-lysine N-methyltransferase MLL2MLL2_HUMANK.ALCAKQR.T  
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformMYH11_HUMANK.ALDEETR.S  
A2341ACTN1Alpha-actinin 1ACTN1_HUMANK.ALDFIASK.G  
A2341ACTN1Alpha-actinin 1ACTN1_HUMANK.ALDFIASK.G  
A2343ACTN3Alpha-actinin 3ACTN3_HUMANK.ALDFIASK.G  
A2343ACTN3Alpha-actinin 3ACTN3_HUMANK.ALDFIASK.G  
A2344ACTN4Alpha-actinin 4ACTN4_HUMANK.ALDFIASK.G  
A0742TTNTitinTITIN_HUMANK.ALDPLHPPGPPK.D  
A276ES100A4, CAPL, MTS1Placental calcium-binding proteinS10A4_HUMANK.ALDVMVSTFHK.Y  
A276ES100A4, CAPL, MTS1Placental calcium-binding proteinS10A4_HUMANK.ALDVMVSTFHK.Y  
A240ABCORBCL-6 corepressorBCOR_HUMANK.ALDWAIPQQR.S  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ALEFVAR.N  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ALEFVAR.N  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ALEFVAR.N  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.ALEFVAR.N  
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_HUMANK.ALESPERPFLAILGGAK.V  
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_HUMANK.ALESPERPFLAILGGAK.V  
A940BDOPEY1Protein dopey-1DOP1_HUMANK.ALETYEIIFKIIGPK.R  
A7041MMEL1, MELL1, MMEL2Membrane metallo-endopeptidase-like 1MMEL1_HUMANK.ALFGTMVEEVR.W  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A742CLRG1, LRGLeucine-rich alpha-2-glycoprotein precursorA2GL_HUMANK.ALGHLDLSGNR.L  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.ALGISPFHEHAEVVFTANDSGPR.R  
A0029ANXA6, ANX6Annexin A6ANXA6_HUMANK.ALIEILATR.T  
A5151SPTAN1, SPTA2, NEASSpectrin alpha chain, brainSPTA2_HUMANK.ALINADELASDVAGAEALLDRHQEHK.G  
A6935LYZ, LZMLysozyme C precursorLYSC_HUMANK.ALIVLGLVLLSVTVQGK.V  
A6935LYZ, LZMLysozyme C precursorLYSC_HUMANK.ALIVLGLVLLSVTVQGK.V  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.ALKEIAVHIGDR.D  
A7185NSUN5, WBSCR20, WBSCR20APutative Methyltransferase NSUN5NSUN5_HUMANK.ALLGR.H  
A5092POTEF, ACT, A26C1BPOTE ankyrin domain family member FPOTAC_HUMANK.ALLLYGADIESKNK.H  
A3862KRT80, KB20Keratin B20K2C80_HUMANK.ALNDKFASLIGK.V  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.ALNNK.F  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.ALNNKFASFIDK.V  
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.ALNNKFASFIDK.V  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHK.Y  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1550S100A8, CAGA, CFAGCalgranulin AS10A8_HUMANK.ALNSIIDVYHKYSLIK.G  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A8270IGHG3Ig gamma-3 chainIGHG3_HUMANK.ALPAPIEK.T  
A721DMMRN2, EMILIN3Multimerin-2MMRN2_HUMANK.ALPGNLTAAVMEANQTGHEFPDR.S  
A721DMMRN2, EMILIN3Multimerin-2MMRN2_HUMANK.ALPGNLTAAVMEANQTGHEFPDR.S  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ALPGQLKPFETLLSQNQGGK.T  
A1702AGT, SERPINA8AngiotensinogenANGT_HUMANK.ALQDQLVLVAAK.L  
A3494AGRN, AGRINAgrinAGRIN_HUMANK.ALQSNHFELSLR.T  
A3494AGRN, AGRINAgrinAGRIN_HUMANK.ALQSNHFELSLR.T  
A7036KMT2C, MLL3, HALRHistone-lysine N-methyltransferase 2CMLL3_HUMANK.ALSAK.Q  
A1469F2Prothrombin precursorTHRB_HUMANK.ALSKHQDFNSAVQLVENFCR.N  
A469BGIMAP2, IMAP2, HIMAP2GTPase IMAP family member 2GIMA2_HUMANK.ALSKLVAACGGR.I  
A4660CEP290, BBS14, NPHP6Centrosomal protein of 290 kDaCE290_HUMANK.ALSRALLELR.A  
A5341GBP4Guanylate binding protein 4GBP4_HUMANK.ALTAGEKAIAAER.A  
A2746ZNF627Zinc finger protein 627ZN627_HUMANK.ALTCLASVR.R  
A6929GAALysosomal alpha-glucosidase precursorLYAG_HUMANK.ALTLR.Y  
A0808MSNMoesinMOES_HUMANK.ALTSELANAR.D  
A0808MSNMoesinMOES_HUMANK.ALTSELANAR.D  
A0808MSNMoesinMOES_HUMANK.ALTSELANARDESK.K  
A5462SKTSickle tail protein homologSKT_HUMANK.ALVDTSCSSNR.D  
A6343LIG1DNA ligase-1DNL1_HUMANK.ALVLPSPRPYVR.I  
A5167SYNE1, MYNE1Nesprin 1SYNE1_HUMANK.ALVTLLSEVEK.M  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6042CPCeruloplasmin precursorCERU_HUMANK.ALYLQYTDETFR.T  
A6039CEL, CELP, CELLBile salt-activated lipaseCEL_HUMANK.AMIAYWTNFAK.T  
A1702AGT, SERPINA8AngiotensinogenANGT_HUMANK.ANAGKPK.D  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSK.V  
A1526SPP1, BNSP, OPNOsteopontin precursorOSTP_HUMANK.ANDESNEHSDVIDSQELSKVSR.E  
A1627C8GComplement component C8 gamma chain precursorCO8G_HUMANK.ANFDAQQFAGTWLLVAVGSACR.F  
A0414ATP6V0A1, ATP6N1, ATP6N1AVacuolar proton translocating ATPase 116 kDa subunit a isoform 1VPP1_HUMANK.ANIPIMDTGENPEVPFPR.D  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANKSSK.L  
A4770DNAH8Dynein, axonemal, heavy polypeptide 8DYH8_HUMANK.ANLAK.Q  
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_HUMANK.ANLEK.A  
A4660CEP290, BBS14, NPHP6Centrosomal protein of 290 kDaCE290_HUMANK.ANLKIDHLEK.E  
A0742TTNTitinTITIN_HUMANK.ANLLANNEYYFRVCAENK.V  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANRPFLVFIR.E  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANSRFATTFYQHLADSK.N  
A8384AT3, SERPINC1, PRO0309Antithrombin-III precursorANT3_HUMANK.ANSRFATTFYQHLADSK.N  
A0454DSPDesmoplakinDESP_HUMANK.ANSSATETINK.L  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.APAAK.A  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.APAAK.A  
A0326VIL2, EZREzrinEZRI_HUMANK.APDFVFYAPR.L  
A0808MSNMoesinMOES_HUMANK.APDFVFYAPR.L  
A0819RDXRadixinRADI_HUMANK.APDFVFYAPR.L  
A8170UK114, HRSP12, PSPRibonuclease UK114UK114_HUMANK.APGAIGPYSQAVLVDR.T  
A038BSUPT16H, FACT140, FACTP140FACT complex subunit SPT16SP16H_HUMANK.APGEQTVPALNLQNAFR.I  
A1563NPNT, EGFL6L, POEMNephronectinNPNT_HUMANK.APGGK.A  
A1563NPNT, EGFL6L, POEMNephronectinNPNT_HUMANK.APGGK.A  
A5808ANKK1, PKK2, SGK288Ankyrin repeat and protein kinase domain-containing protein 1ANKK1_HUMANK.APGPK.Y  
A5403NAV1, POMFIL3, STEERIN1Neuron navigator 1NAV1_HUMANK.APKGLGK.V  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.APKSPAK.A  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMANK.APKVLIYK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMANK.APKVLIYK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMANK.APKVLIYK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV104_HUMANK.APKVLIYK.S  
A901ARAI1Retinoid-acid induced protein 1RAI1_HUMANK.APLICTK.E  
A2408KMT2D, MLL2, ALRHistone-lysine N-methyltransferase MLL2MLL2_HUMANK.APLTPR.A  
A0849AHNAK, PM227Neuroblast differentiation associated protein AHNAKAHNK_HUMANK.APNISMPDVDLNLKGPK.I  
A0742TTNTitinTITIN_HUMANK.APPPPK.V  
A1851CAMK2B, CAM2, CAMKBCalcium/calmodulin-dependent protein kinase IIBKCC2B_HUMANK.APRVPDILSSVR.R  
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMANK.APSGGK.K  
A493AH2AFX, H2AXHistone H2A.xH2AX_HUMANK.APSGGKK.A  
A3862KRT80, KB20Keratin B20K2C80_HUMANK.APSRK.K  
A7118NAV2, HELAD1, POMFIL2Neuron navigator 2NAV2_HUMANK.AQAEMQSSASSKDSSQSK.I  
A7118NAV2, HELAD1, POMFIL2Neuron navigator 2NAV2_HUMANK.AQAEMQSSASSKDSSQSK.I  
A1575DST, BPAG1, DMHDystoninBPAEA_HUMANK.AQEESSAMMQWLQK.M  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQEREQIK.T  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQEREQIK.T  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQEREQIK.T  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDK.C  
A7540PTGDS, PDS, PGDS2Prostaglandin-H2 D-isomerase precursorPTGDS_HUMANK.AQGFTEDTIVFLPQTDKCMTEQ.-  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.AQIHDLVLVGGSTR.I  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.AQIHDLVLVGGSTR.I  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.AQIHGGILR.L  
A1575DST, BPAG1, DMHDystoninBPAEA_HUMANK.AQIQEQK.L  
A1820EEF1A1, EEF1A, EF1AElongation factor 1-alpha 1EF1A1_HUMANK.AQKAK.-  
A4770DNAH8Dynein, axonemal, heavy polypeptide 8DYH8_HUMANK.AQKIVDEIDSEK.V  
A2481ARSAArylsulfatase A precursorARSA_HUMANK.AQLDAAVTFGPSQVAR.G  
A2481ARSAArylsulfatase A precursorARSA_HUMANK.AQLDAAVTFGPSQVAR.G  
A2481ARSAArylsulfatase A precursorARSA_HUMANK.AQLDAAVTFGPSQVAR.G  
A2481ARSAArylsulfatase A precursorARSA_HUMANK.AQLDAAVTFGPSQVAR.G  
A2481ARSAArylsulfatase A precursorARSA_HUMANK.AQLDAAVTFGPSQVAR.G  
A9927CCDC88A, APE, GRDNCoiled-coil domain containing 88AGRDN_HUMANK.AQLEK.T  
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14UBP14_HUMANK.AQLFALTGVQPAR.Q  
A3962MYH14, FP17425Myosin-14MYH14_HUMANK.AQMASAGQGKEEAVK.Q  
A0742TTNTitinTITIN_HUMANK.AQNEVGSDTCVCTVKLK.E  
A0742TTNTitinTITIN_HUMANK.AQNEVGSDTCVCTVKLK.E  
A694AMED27, CRSP34, CRSP8Mediator of RNA polymerase II transcription subunit 27MED27_HUMANK.AQPTTLVLPPQYVDDVISR.I  
A0454DSPDesmoplakinDESP_HUMANK.AQQIHSQTSQQYPLYDLDLGK.F  
A8404CST6Cystatin M precursorCYTM_HUMANK.AQSQLVAGIK.Y  
A8404CST6Cystatin M precursorCYTM_HUMANK.AQSQLVAGIK.Y  
A8404CST6Cystatin M precursorCYTM_HUMANK.AQSQLVAGIK.Y  
A8404CST6Cystatin M precursorCYTM_HUMANK.AQSQLVAGIK.Y  
A2528CELF5, BRUNOL5CUG-BP and ETR-3 like factor 5CELF5_HUMANK.AQTALHEQK.T  
A3862KRT80, KB20Keratin B20K2C80_HUMANK.AQYDAVAAR.S  
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75K2C75_HUMANK.AQYEDIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.AQYEEIANR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3846KRT6C, KRT6E, KRT6DKeratin, type II cytoskeletal 6CK2C6C_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3847KRT6B, K6B, KRTL1Keratin, type II cytoskeletal 6BK2C6B_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.AQYEEIAQR.S  
A4880KRT79, K6L, KB38Keratin, type II cytoskeletal 79K2C79_HUMANK.AQYELIAQR.S  
A4523SCNN1GAmiloride-sensitive sodium channel gamma-subunitSCNNG_HUMANK.ARDFFTGR.K  
A4634CAPG, AFCP, MCPGelsolin-like capping proteinCAPG_HUMANK.ARDLALAIR.D  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.AREDIFMETLK.D  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.AREDIFMETLK.D  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.AREDIFMETLK.D  
A5980CASP14Caspase-14 precursorCASPE_HUMANK.AREGSEEDLDALEHMFR.Q  
A0742TTNTitinTITIN_HUMANK.ARIDVTPVGSK.L  
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunitPRKDC_HUMANK.ARLPPDVLR.W  
A0454DSPDesmoplakinDESP_HUMANK.ARLQR.L  
A9807AZU1Azurocidin precursorCAP7_HUMANK.ARPRQFPFLASIQNQGR.H  
A501EWDR96WD repeat-containing protein 96CJ079_HUMANK.ARTVEELK.E  
A0742TTNTitinTITIN_HUMANK.ARVPEEPK.R  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.ARVQVVAGK.K  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.ARVQVVAGK.K  
A7118NAV2, HELAD1, POMFIL2Neuron navigator 2NAV2_HUMANK.ASAPAGALKTPGTGK.T  
A1183BARD1BRCA1-associated RING domain protein 1BARD1_HUMANK.ASARSGK.K  
A5404NAV3, POMFIL1, STEERIN3Neuron navigator 3NAV3_HUMANK.ASASSCPAPLEGR.E  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ASCLYGQLPK.F  
A1961GSTP1, FAEES3, GST3Glutathione S-transferase PGSTP1_HUMANK.ASCLYGQLPK.F  
A0742TTNTitinTITIN_HUMANK.ASCTTHLYIKAPAK.F  
A9861CCDC88C, DAPLEProtein DapleDAPLE_HUMANK.ASDPPAIGGQPGPPAK.K  
A5821ARG1Arginase 1ARGI1_HUMANK.ASEQLAGKVAEVK.K  
A2325SPECC1, CYTSB, NSP5Cytospin-BSPEC1_HUMANK.ASESDAEIKDMK.E  
A9051SHOC2Leucine-rich repeat protein SHOC-2SHOC2_HUMANK.ASGGFGK.E  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.ASGPPVSELITK.A  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.ASGPPVSELITK.A  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.ASGPPVSELITK.A  
A470AHIST1H1C, H1F2Histone H1.2H12_HUMANK.ASGPPVSELITK.A  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.ASGPPVSELITK.A  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.ASGPPVSELITK.A  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.ASGPPVSELITK.A  
A471AHIST1H1D, H1F3Histone H1.3H13_HUMANK.ASGPPVSELITK.A  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.ASGPPVSELITK.A  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.ASGPPVSELITK.A  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.ASGPPVSELITK.A  
A472AHIST1H1E, H1F4Histone H1.4H14_HUMANK.ASGPPVSELITK.A  
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.ASLEGNLAETENR.Y  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETK.G  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETK.G  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETK.G  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETK.G  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETKGR.Y  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETKGR.Y  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.ASLENSLEETKGR.Y  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  
A3748KRT16, KRT16AKeratin, type I cytoskeletal 16K1C16_HUMANK.ASLENSLEETKGR.Y  
A7517NPEPPS, PSAPuromycin-sensitive aminopeptidasePSA_HUMANK.ASPPTV.-  
A266BZNF644, ZEP2, BM-005Zinc finger protein 644ZN644_HUMANK.ASQHQVLFLLSDVAHAKNPTHSNK.K  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.ASSAK.Q  
A2791ZNF551, KOX23Zinc finger protein 551ZN551_HUMANK.ASSHK.H  
A828CADAMTSL3ADAM-TSL3 precursorATL3_HUMANK.ASSHK.S  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A8273IGK, SDNK1, A30Ig kappa chainKV106_HUMANK.ASSLESGVPSR.F  
A6248DCP1A, SMIF, HSA275986mRNA-decapping enzyme 1ADCP1A_HUMANK.ASSPSPLTIGTPESQR.K  
A557CSTARD9, x529StAR-related lipid transfer protein 9STAR9_HUMANK.ASSRLDDGTTDHR.H  
A1494FGG, PRO2061Fibrinogen gamma chain precursorFIBG_HUMANK.ASTPNGYDNGIIWATWK.T  
A1494FGG, PRO2061Fibrinogen gamma chain precursorFIBG_HUMANK.ASTPNGYDNGIIWATWK.T  
A0371PRDX1, PAGA, PAGBPeroxiredoxin 1PRDX1_HUMANK.ATAVMPDGQFK.D  
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2PRDX2_HUMANK.ATAVVDGAFK.E  
A0372PRDX2, NKEFB, TDPX1Peroxiredoxin 2PRDX2_HUMANK.ATAVVDGAFKEVK.L  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.ATCAPQHGAPGPGPADASK.V  
A2331MYH11, SMMHCMyosin heavy chain, smooth muscle isoformMYH11_HUMANK.ATDKSFVEK.L  
A3166MYH9Myosin heavy chain 9, non-muscleMYH9_HUMANK.ATDKSFVEK.V  
A3962MYH14, FP17425Myosin-14MYH14_HUMANK.ATDKSFVEK.V  
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.ATEHLSTLSEK.A  
A1552APOA1, A175PApolipoprotein A-I precursorAPOA1_HUMANK.ATEHLSTLSEK.A  
A3494AGRN, AGRINAgrinAGRIN_HUMANK.ATERADYVALAIVDGHLQLSYNLGSQPVVLR.S  
A1610LRP2Low-density lipoprotein receptor-related protein 2 precursorLRP2_HUMANK.ATGANK.I  
A0742TTNTitinTITIN_HUMANK.ATGLQEGTEYEFR.V  
A0454DSPDesmoplakinDESP_HUMANK.ATGSEVSQRK.Q  
A0454DSPDesmoplakinDESP_HUMANK.ATGSEVSQRK.Q  
A2483ARSBArylsulfatase B precursorARSB_HUMANK.ATGVWGPWM.-  
A2167BAZ1A, ACF1, WCRF180Bromodomain adjacent to zinc finger domain protein 1ABAZ1A_HUMANK.ATKER.D  
A8438SERPINA4, KST, PI4Kallistatin precursorKAIN_HUMANK.ATLDVDEAGTEAAAATSFAIK.F  
A2341ACTN1Alpha-actinin 1ACTN1_HUMANK.ATLPDADKER.L  
A2341ACTN1Alpha-actinin 1ACTN1_HUMANK.ATLPDADKER.L  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWK.A  
A8364IGL, IGLV3-22, V2-15Ig lambda chainLAC_HUMANK.ATLVCLISDFYPGAVTVAWKADSSPVK.A  
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinPDC6I_HUMANK.ATLVK.S  
A0462DMD, DAG1DystrophinDMD_HUMANK.ATMQDLEQR.R  
A663DLKAP, MARF1Meiosis arrest female protein 1LKAP_HUMANK.ATPGK.G  
A1284PRKDC, HYRC, HYRC1DNA-dependent protein kinase catalytic subunitPRKDC_HUMANK.ATQMPEGGQGAPPMYQLYK.R  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.ATQVSK.G  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.ATQVSK.G  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.ATQVSK.G  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.ATQVSK.G  
A0419GSNGelsolin precursor, plasmaGELS_HUMANK.ATQVSKGIR.D  
A5155SPTBN5, SPTBN4, BSPECVSpectrin beta chain, brain 4SPTN5_HUMANK.ATSLPNNVAR.D  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_HUMANK.ATVEDEKLQGK.I  
A828CADAMTSL3ADAM-TSL3 precursorATL3_HUMANK.AVATSVLHLLERR.W  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.AVDAALK.K  
A1539KNG1, BDK, KNGKininogen-1KNG1_HUMANK.AVDAALKK.Y  
A3617ENO3Beta enolaseENOB_HUMANK.AVENINNTLGPALLQK.K  
A7224OBSCNObscurinOBSCN_HUMANK.AVFAKEQLVHNEVR.T  
A1631HPHaptoglobin precursorHPT_HUMANK.AVGDK.L  
A539DHPR, Hp2Haptoglobin-related protein precursorHPTR_HUMANK.AVGDK.L  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.AVGGLGK.L  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.AVGGLGKLGK.D  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.AVGGLGKLGK.D  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.AVGGLGKLGK.D  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.AVGGLGKLGK.D  
A643CTF, PRO1400Serotransferrin precursorTRFE_HUMANK.AVGNLR.K  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.AVGSLASYCAAGR.G  
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.AVIQYSCEETFYTMK.V  
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.AVIQYSCEETFYTMK.V  
A1606MASP2, MASP-2Mannan-binding lectin serine protease 2MASP2_HUMANK.AVIQYSCEETFYTMK.V  
A280ES100A16, S100F, AAG13S100 calcium-binding protein A16S10AG_HUMANK.AVIVLVENFYK.Y  
A4009CKAP5, ch-TOGCytoskeleton-associated protein 5CKAP5_HUMANK.AVKPFLADVDKLK.L  
A735CA1BGAlpha-1B-glycoprotein precursorA1BG_HUMANK.AVKTVR.T  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVK.I  
A8381SERPINA3, AACT, GIG24Alpha-1-antichymotrypsin precursorAACT_HUMANK.AVLDVFEEGTEASAATAVKITLLSALVETR.T  
A8515SERPINA7, TBGThyroxine-binding globulin precursorTHBG_HUMANK.AVLHIGEK.G  
A2228PHF2PHD finger protein 2PHF2_HUMANK.AVLPTPVTKPKLDSAAYK.S  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursorA1AT_HUMANK.AVLTIDEK.G  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AVMDDFAAFVEK.C  
A0742TTNTitinTITIN_HUMANK.AVPEAPTPVPK.K  
A5964CA2Carbonic anhydrase 2CAH2_HUMANK.AVQQPDGLAVLGIFLK.V  
A5964CA2Carbonic anhydrase 2CAH2_HUMANK.AVQQPDGLAVLGIFLK.V  
A6300DGKH, DGKH-1, DGKH-2Diacylglycerol kinase etaDGKH_HUMANK.AVRQVIEEAGK.V  
A4660CEP290, BBS14, NPHP6Centrosomal protein of 290 kDaCE290_HUMANK.AVSDADRQR.I  
A8400CSTB, CST6, STFBCystatin BCYTB_HUMANK.AVSFKSQVVAGTNYFIK.V  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A1549SERPINA5, PCI, PLANH3Plasma serine protease inhibitorIPSP_HUMANK.AVVEVDESGTR.A  
A663DLKAP, MARF1Meiosis arrest female protein 1LKAP_HUMANK.AVVQMENLQDAIGAVNSLHRYK.I  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.AWAVAR.L  
A6427ENOX1, PIG38, CNOXEcto-NOX disulfide-thiol exchanger 1ENOX1_HUMANK.AWDHFSKAQR.K  
A1575DST, BPAG1, DMHDystoninBPAEA_HUMANK.AWKDR.I  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.AYLEEECPATLR.K  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.AYLEEECPATLRK.Y  
A0537ANXA2, ANX2, ANX2L4Annexin A2ANXA2_HUMANK.AYTNFDAERDALNIETAIK.T  
A8844IGSF8, CD81P3, EWI2Immunoglobulin superfamily member 8 precursorIGSF8_HUMANK.AYVRGSGTR.L  
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.AYYHLLEQVAPK.G  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.CASLQKFGER.A  
A1328PEBP1, PBP, PEBPPhosphatidylethanolamine-binding protein 1PEBP1_HUMANK.CDEPILSNRSGDHR.G  
A0742TTNTitinTITIN_HUMANK.CDITGLLEGQEYK.F  
A0026HD, IT15, HTTHuntingtinHD_HUMANK.CDQGQADPVVAVAR.D  
A0742TTNTitinTITIN_HUMANK.CEAQSYTAIK.L  
A1466FN1, FNFibronectinFINC_HUMANK.CERHTSVQTTSSGSGPFTDVR.A  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CFCMGVSR.H  
A1628C9Complement component C9 precursorCO9_HUMANK.CHTCQNGGTVILMDGK.C  
A0919PLEK, P47PleckstrinPLEK_HUMANK.CIEGGQKFAR.K  
A9061SOS2Son of sevenless protein homolog 2SOS2_HUMANK.CIVEAENFEER.V  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CKAGFFGDAMK.A  
A798ANR1H2, LXRB, NEROxysterols receptor LXR-betaNR1H2_HUMANK.CKEAGMR.E  
A1939IGH, VH1, IGHG1Immunoglobulin G1 Fab heavy chain variable regionIGHG1_HUMANK.CKVSNK.A  
A195AAZGP1, ZAG, ZNGP1Zinc-alpha-2-glycoprotein precursorZA2G_HUMANK.CLAYDFYPGK.I  
A0742TTNTitinTITIN_HUMANK.CLEGQTARFDLK.V  
A1599CFH, HF, HF1Complement factor H precursorCFAH_HUMANK.CLGEKWSHPPSCIK.T  
A1599CFH, HF, HF1Complement factor H precursorCFAH_HUMANK.CLGEKWSHPPSCIK.T  
A242BZNF407Zinc finger protein 407ZN407_HUMANK.CLHCEFSAHSSASLELHVK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CLIHDGAAPISLEWK.T  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CLIHDGAAPISLEWK.T  
A0742TTNTitinTITIN_HUMANK.CLLDDEAEYSCEVRTAR.T  
A0742TTNTitinTITIN_HUMANK.CLLDDEAEYSCEVRTAR.T  
A2709ZNF287, ZKSCAN13Zinc finger protein 287ZN287_HUMANK.CNECGKAFIYSSSLNQHQR.T  
A0742TTNTitinTITIN_HUMANK.CNYTNIQETYFEVTELTEDQRYEFR.V  
A648CTTR, PALB, TBPATransthyretin precursorTTHY_HUMANK.CPLMVKVLDAVR.G  
A1471VTNVitronectin precursorVTNC_HUMANK.CQCDELCSYYQSCCTDYTAECKPQVTR.G  
A9139UMODUromodulin precursorUROM_HUMANK.CQLKSLGFDK.V  
A9139UMODUromodulin precursorUROM_HUMANK.CQLKSLGFDK.V  
A5027PCDH17, PCDH68, PCH68Protocadherin 17PCD17_HUMANK.CQLSLEVFANDK.E  
A1575DST, BPAG1, DMHDystoninBPAEA_HUMANK.CSFLETKLQGIGHFR.N  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.CSGQRGDR.G  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.CSGQRGDR.G  
A982CCCDC18, NY-SAR-41, NY-SAR-24Coiled-coil domain-containing protein 18CCD18_HUMANK.CSQLLTLEKQLEEK.I  
A0742TTNTitinTITIN_HUMANK.CVLSWFPPLDDGGAK.I  
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.CVPNSNER.Y  
A2624PTPRS, PTPsigma, BPTP-2Receptor-type protein-tyrosine phosphatase S precursorPTPRS_HUMANK.CVSVR.S  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHK.R  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.CVVPGQAHAQVTWHKR.G  
A5403NAV1, POMFIL3, STEERIN1Neuron navigator 1NAV1_HUMANK.DADAKK.K  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3809KRT12Keratin, type I cytoskeletal 12K1C12_HUMANK.DAEAWFIEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3828KRT25D, KRT28Keratin, type I cytoskeletal 28K1C28_HUMANK.DAEAWFNEK.S  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  
A3824KRT10, KPPKeratin, type I cytoskeletal 10K1C10_HUMANK.DAEAWFNEKSK.E  
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.DAEDWFFSK.T  
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.DAEDWFFSK.T  
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.DAEDWFFSK.T  
A3743KRT17Keratin, type I cytoskeletal 17K1C17_HUMANK.DAEDWFFSKTEELNR.E  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTK.T  
A1579K14, KRT14Keratin, type I cytoskeletal 14K1C14_HUMANK.DAEEWFFTKTEELNR.E  
A0204FLNA, FLN, FLN1Filamin AFLNA_HUMANK.DAGEGGLSLAIEGPSK.A  
A4815FLNC, ABPL, FLN2Filamin CFLNC_HUMANK.DAGEGGLSLAVEGPSK.A  
A4815FLNC, ABPL, FLN2Filamin CFLNC_HUMANK.DAGEGGLSLAVEGPSK.A  
A8077TXNDC17, TXNL5Thioredoxin domain-containing protein 17TXD17_HUMANK.DAGGK.S  
A8077TXNDC17, TXNL5Thioredoxin domain-containing protein 17TXD17_HUMANK.DAGGK.S  
A8077TXNDC17, TXNL5Thioredoxin domain-containing protein 17TXD17_HUMANK.DAGGK.S  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_HUMANK.DAGTIAGLNVLR.I  
A0146HSPA8, HSC70, HSP73Heat shock cognate 71 kDa proteinHSP7C_HUMANK.DAGTIAGLNVLRIINEPTAAAIAYGLDK.K  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.DAGVIAGLNVLR.I  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.DAGVIAGLNVLR.I  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.DAGVIAGLNVLR.I  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.DAGVIAGLNVLR.I  
A2007HSPA1A, HSPA1B, HSPA1Heat shock 70 kDa protein 1HSP71_HUMANK.DAGVIAGLNVLR.I  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMHS71L_HUMANK.DAGVIAGLNVLR.I  
A2008HSPA1LHeat shock 70 kDa protein 1-HOMHS71L_HUMANK.DAGVIAGLNVLR.I  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.DAHSK.R  
A3850KRT4, CYK4Keratin, type II cytoskeletal 4K2C4_HUMANK.DAHSK.R  
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinPDC6I_HUMANK.DAIIAK.L  
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinPDC6I_HUMANK.DAIIAK.L  
A277CPDCD6IP, AIP1, ALIXProgrammed cell death 6-interacting proteinPDC6I_HUMANK.DAIIAK.L  
A0454DSPDesmoplakinDESP_HUMANK.DAINR.S  
A0492STIP1Stress-induced-phosphoprotein 1STIP1_HUMANK.DAKLYSNR.A  
A0742TTNTitinTITIN_HUMANK.DAKMHTWR.Q  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DAKNK.L  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DAKNK.L  
A3849KRT1, KRTAKeratin, type II cytoskeletal 1K2C1_HUMANK.DAKNK.L  
A4877KRT6A, K6A, KRT6DKeratin, type II cytoskeletal 6AK2C6A_HUMANK.DAKNK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A1531KRT8, CYK8Keratin, type II cytoskeletal 8K2C8_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DANAK.L  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.DAQAK.L  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.DAQAK.L  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.DAQAK.L  
A4879KRT74, K6IRS4, KB37Keratin 74K2C74_HUMANK.DAQAK.L  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.DAQAK.V  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.DAQAK.V  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.DAQAK.V  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.DAQAK.V  
A3861KRT78, K5B, KB40Keratin, type II cytoskeletal 78K2C78_HUMANK.DAQAK.V  
A4880KRT79, K6L, KB38Keratin, type II cytoskeletal 79K2C79_HUMANK.DAQKK.L  
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75K2C75_HUMANK.DARAK.L  
A3851KRT75, K6HF, KB18Keratin, type II cytoskeletal 75K2C75_HUMANK.DARAK.L  
A3853KRT71, K6IRS1, KB34Keratin, type II cytoskeletal 71K2C71_HUMANK.DARAK.L  
A3854KRT72, K6IRS2, KB35Keratin, type II cytoskeletal 72K2C72_HUMANK.DARAK.L  
A4878KRT73, K6IRS3, KB36Keratin, type II cytoskeletal 73K2C73_HUMANK.DARAK.L  
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANK.DARAK.Q  
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANK.DARAK.Q  
A3848KRT7, SCLKeratin, type II cytoskeletal 7K2C7_HUMANK.DARAK.Q  
A1669KRT5Keratin, type II cytoskeletal 5K2C5_HUMANK.DARNK.L  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.DARNK.L  
A3852KRT2, KRT2A, KRT2EKeratin, type II cytoskeletal 2 epidermalK22E_HUMANK.DARNK.L  
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_HUMANK.DASGNKVK.A  
A430AZFPM2, FOG2, ZNF89BZinc finger protein, multitype 2FOG2_HUMANK.DASSDTELDKCEK.K  
A6541G2E3G2/M phase-specific E3 ubiquitin-protein ligaseG2E3_HUMANK.DASWELEENAYQELLQHYER.C  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENO1B_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENO1B_HUMANK.DATNVGDEGGFAPNILENK.E  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENKEGLELLK.T  
A3615ENO1, ENO1L1, MBPB1Alpha enolaseENOA_HUMANK.DATNVGDEGGFAPNILENKEGLELLK.T  
A3617ENO3Beta enolaseENOB_HUMANK.DATNVGDEGGFAPNILENNEALELLK.T  
A3617ENO3Beta enolaseENOB_HUMANK.DATNVGDEGGFAPNILENNEALELLK.T  
A3617ENO3Beta enolaseENOB_HUMANK.DATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDK.V  
A274ES100P, S100ES-100P proteinS100P_HUMANK.DAVDKLLK.D  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGK.G  
A9866PIF, DCD, AIDDDermcidin precursorDCD_HUMANK.DAVEDLESVGKGAVHDVK.D  
A0433TPI1, TPI, TIMTriosephosphate isomerase 1TPIS_HUMANK.DCGATWVVLGHSERR.H  
A643CTF, PRO1400Serotransferrin precursorTRFE_HUMANK.DCHLAQVPSHTVVAR.S  
A1712LTF, LF, GIG12Lactotransferrin precursorTRFL_HUMANK.DCHLARVPSHAVVAR.S  
A7372PGK1, PGKA, MIG10Phosphoglycerate kinase 1PGK1_HUMANK.DCVGPEVEK.A  
A8111USP14, TGTUbiquitin carboxyl-terminal hydrolase 14UBP14_HUMANK.DDDWGNIK.I  
A0742TTNTitinTITIN_HUMANK.DDFGK.Y  
A0742TTNTitinTITIN_HUMANK.DDFGK.Y  
A0742TTNTitinTITIN_HUMANK.DDGGSEITNYILEK.R  
A0742TTNTitinTITIN_HUMANK.DDGGSPVINYIVEKQDTR.K  
A3482PLXNA1, NOV, PLXN1Plexin-A1PLXA1_HUMANK.DDGLTAVAAYDYR.G  
A4390SEC63, SEC63LTranslocation protein SEC63 homologSEC63_HUMANK.DDGSDR.D  
A5086LCP1, PLS2Plastin-2PLSL_HUMANK.DDIQR.A  
A3844KRT3Keratin, type II cytoskeletal 3K2C3_HUMANK.DDLAR.L  
A3845KRT76, KRT2B, KRT2PKeratin, type II cytoskeletal 2 oralK22O_HUMANK.DDLAR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A1581ALB, GIG20, GIG42Serum albumin precursorALBU_HUMANK.DDNPNLPR.L  
A0742TTNTitinTITIN_HUMANK.DDQEISASEKYK.F  
A2040CHD6, CHD5, RIGBChromodomain-helicase-DNA-binding protein 6CHD6_HUMANK.DDVEKNLAPK.Q  
A0742TTNTitinTITIN_HUMANK.DDVEPPRVMMDVK.F  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCR.D  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCR.D  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCR.D  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCRDFILK.W  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCRDFILK.W  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCRDFILK.W  
A1423COL6A3Collagen alpha 3(VI) chain precursorCO6A3_HUMANK.DEGTCRDFILK.W  
A0742TTNTitinTITIN_HUMANK.DEKSLVEESQLPEGR.K  
A0742TTNTitinTITIN_HUMANK.DELAPPTLHLDFR.D  
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANK.DEMAR.H  
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANK.DEMAR.H  
A0534GFAPGlial fibrillary acidic protein, astrocyteGFAP_HUMANK.DEMARHLQEYQDLLNVK.L  
A0010SPTBN1, SPTB2, RPL23AP13Spectrin beta chain, brain 1SPTB2_HUMANK.DEQSAVSMLK.K  
A4824FREM3FRAS1 related extracellular matrix 3 precursorFREM3_HUMANK.DETAK.K  
A0742TTNTitinTITIN_HUMANK.DEVELPRISMDPK.F  
A0742TTNTitinTITIN_HUMANK.DEVELPRISMDPK.F  
A7271PLA2G6, IPLA2, PLPLA985 kDa calcium-independent phospholipase A2PA2G6_HUMANK.DEVFR.G  
A6248DCP1A, SMIF, HSA275986mRNA-decapping enzyme 1ADCP1A_HUMANK.DEYER.N  
A1598C3, CPAMD1Complement C3 precursorCO3_HUMANK.DFDFVPPVVR.W  
A4771DNAH9, DNAH17L, DNAL1Dynein heavy chain 9, axonemalDYH9_HUMANK.DFDLFDK.I  
A7472ACPPProstatic acid phosphatase precursorPPAP_HUMANK.DFIATLGKLSGLHGQDLFGIWSK.V  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  
A1555HSPG2Basement membrane-specific heparan sulfate proteoglycan core proteinPGBM_HUMANK.DFISLGLQDGHLVFR.Y  
A3494AGRN, AGRINAgrinAGRIN_HUMANK.DFLALALLDGR.V