PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A9781ADAMTSL4, TSRC1, PP1396ADAMTS-like protein 4 precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836RPDPFPSVPR0.6 (delta mass [ppm])2    
16948836RPDPFPSVPR0.1 (delta mass [ppm])2    
16948836RPSSQGWASPQVAGR0.4 (delta mass [ppm])3    
16948836RPSSQGWASPQVAGR0.1 (delta mass [ppm])3    
16948836SELSLISSR0 (delta mass [ppm])2    
16948836SELSLISSR0.6 (delta mass [ppm])2    
16684767RACSQAPCPPEQPDPRA 2    
16684767RALQCAAFNSQEFMGQLYQWEPFTEVQGSQRC 3    
16684767RCLSPGCDGILGSGRR 2    
16684767REVQCLSTN#QTLSTRC 2    
16684767RHTEKVQDGTLCQPGAPDICVAGRC 3    
16684767RLVSGN#LTDRG 2    
16684767RTCQLPTVQLHPSLPLPPRPPRH 3    

Compile date 12-23-2014© PADB initiative