PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A8369A1A, SERPINA1, AATAlpha-1-antitrypsin precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836AGFSWIEVTFKNPLVWVHASPEHVVVTR0 (delta mass [ppm])4    
16709260AVLTIDEK-0.976004011 (delta mass [ppm])1   MS2 score: 45 
16948836AVLTIDEK0.2 (delta mass [ppm])2    
16948836AVLTIDEK0 (delta mass [ppm])2    
16948836AVLTIDEK0.7 (delta mass [ppm])1    
16948836AVLTIDEK1.3 (delta mass [ppm])1    
16948836AVLTIDEK1.1 (delta mass [ppm])2    
16948836AVLTIDEK1.3 (delta mass [ppm])2    
16948836AVLTIDEK1.8 (delta mass [ppm])2    
16948836AVLTIDEK0.8 (delta mass [ppm])2    
16948836AVLTIDEK1.2 (delta mass [ppm])2    
16948836AVLTIDEK2.5 (delta mass [ppm])2    
16948836AVLTIDEK2.2 (delta mass [ppm])2    
16316981AVLTIDEK      peptide count: 3
16948836AVLTIDEKGTEAAGAMFLEAIPMSIPPEVK1.4 (delta mass [ppm])3    
16948836DTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRR2.3 (delta mass [ppm])5    
16709260DTEEEDFHVDQVTTVK1.277204545 (delta mass [ppm])2   MS2 score: 89 
16948836DTEEEDFHVDQVTTVK0.8 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK1.1 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK2.2 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK1.1 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK0.6 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK1.9 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK3.9 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK4.5 (delta mass [ppm])2    
16948836DTEEEDFHVDQVTTVK0.1 (delta mass [ppm])2    
16316981DTEEEDFHVDQVTTVK      peptide count: 7
16948836DTVFALVNYIFFK4.4 (delta mass [ppm])2    
16948836DTVFALVNYIFFK0.8 (delta mass [ppm])2    
16948836DTVFALVNYIFFK1 (delta mass [ppm])2    
16948836DTVFALVNYIFFK2.1 (delta mass [ppm])2    
16948836DTVFALVNYIFFK0.8 (delta mass [ppm])2    
16948836DTVFALVNYIFFK3.3 (delta mass [ppm])2    
18004714EAIPMSIPPEVKFNKPF  24.94 (CE [min])   
17494094EDPQGDAAQKTDTSHHDQDHPTFNKI      
16948836EKAGFSWIEVTFK2.8 (delta mass [ppm])2    
16948836EKAGFSWIEVTFKNPLVWVHASPEHVVVTR0.1 (delta mass [ppm])4    
16901338ELDRDTVFALVNYIFFK0.25 (delta mass [ppm])3   MS2 score: 42 
16948836ELDRDTVFALVNYIFFK0.4 (delta mass [ppm])2    
16948836ELDRDTVFALVNYIFFK3.2 (delta mass [ppm])3    
16948836ELDRDTVFALVNYIFFK2.1 (delta mass [ppm])3    
16948836ELDRDTVFALVNYIFFK3.3 (delta mass [ppm])2    
16948836ELDRDTVFALVNYIFFK1.9 (delta mass [ppm])3    
16948836ELDRDTVFALVNYIFFK0.6 (delta mass [ppm])2    
16948836ELDRDTVFALVNYIFFK0.4 (delta mass [ppm])3    
16948836ELDRDTVFALVNYIFFK2 (delta mass [ppm])2    
16948836ELDRDTVFALVNYIFFK0.6 (delta mass [ppm])3    
16948836ELDRDTVFALVNYIFFKGK1.8 (delta mass [ppm])4    
16948836ETLFSVMPGLK2.7 (delta mass [ppm])2    
16709260FLEDVKK-0.181426391 (delta mass [ppm])2   MS2 score: 37 
16948836FLEDVKK0 (delta mass [ppm])2    
16948836FLEDVKK1.5 (delta mass [ppm])2    
16948836FLEDVKK0.6 (delta mass [ppm])2    
16948836FLEDVKK1.7 (delta mass [ppm])2    
16948836FLEDVKK0.3 (delta mass [ppm])2    
16948836FLEDVKK1.6 (delta mass [ppm])2    
16948836FLEDVKK0.4 (delta mass [ppm])2    
16709260FLENEDR-0.442686693 (delta mass [ppm])2   MS2 score: 39 
16948836FLENEDR1.1 (delta mass [ppm])2    
16948836FLENEDR0.6 (delta mass [ppm])2    
16948836FLENEDR2.8 (delta mass [ppm])2    
16948836FLENEDR1 (delta mass [ppm])2    
16948836FLENEDR1.7 (delta mass [ppm])2    
16948836FLENEDR3 (delta mass [ppm])2    
16709260FLENEDRR-0.079740063 (delta mass [ppm])2   MS2 score: 42 
16948836FLENEDRR2.5 (delta mass [ppm])3    
16948836FLENEDRR0.4 (delta mass [ppm])3    
16948836FLENEDRR0.7 (delta mass [ppm])3    
16948836FLENEDRR3.1 (delta mass [ppm])3    
16709260FNKPFVFLMIDQNTK-0.299844453 (delta mass [ppm])2   MS2 score: 58 
16709260FNKPFVFLMIEQNTK0.011860029 (delta mass [ppm])2   MS2 score: 51 
16948836FNKPFVFLMIEQNTK0.9 (delta mass [ppm])3    
16948836FNKPFVFLMIEQNTK1.3 (delta mass [ppm])2    
16948836FNKPFVFLMIEQNTK0.3 (delta mass [ppm])2    
16948836FNKPFVFLMIEQNTK1.1 (delta mass [ppm])2    
16948836FNKPFVFLMIEQNTK1.3 (delta mass [ppm])3    
16948836FNKPFVFLMIEQNTK0.8 (delta mass [ppm])3    
16948836FNKPFVFLMIEQNTK2.3 (delta mass [ppm])3    
16948836FNKPFVFLMIEQNTK0.3 (delta mass [ppm])3    
16948836FNKPFVFLMIEQNTKSPLFMGK0.7 (delta mass [ppm])3    
16948836FSSHVGGTLGQFYQEVLWGSPAASDDGR0.2 (delta mass [ppm])3    
16948836FSSHVGGTLGQFYQEVLWGSPAASDDGRR2.7 (delta mass [ppm])4    
16948836GKWERPFEVK0.7 (delta mass [ppm])3    
16316981GKWERPFEVK      peptide count: 8
16709260GKWERPFEVKDTEEEDFHVDQVTTVK-0.16266802 (delta mass [ppm])3   MS2 score: 47 
16709260GTEAAGAMFLEAIPMSIPPEVK0.400773631 (delta mass [ppm])2   MS2 score: 49 
16948836GTEAAGAMFLEAIPMSIPPEVK1.7 (delta mass [ppm])2    
16948836GTEAAGAMFLEAIPMSIPPEVK1.5 (delta mass [ppm])2    
16948836GTEAAGAMFLEAIPMSIPPEVK0.1 (delta mass [ppm])2    
16948836GTEAAGAMFLEAIPMSIPPEVK0 (delta mass [ppm])2    
16948836HRQGPVNLLSDPEQGVEVTGQYER1.6 (delta mass [ppm])3    
16948836ILDDLSPR1.2 (delta mass [ppm])2    
16901338ITPNLAEFAFSLYR1.44 (delta mass [ppm])2   MS2 score: 66 
16901338ITPNLAEFAFSLYR2   MS2 score: 55 
16948836ITPNLAEFAFSLYR1.8 (delta mass [ppm])2    
16948836ITPNLAEFAFSLYR2.5 (delta mass [ppm])2    
16948836ITPNLAEFAFSLYR1.8 (delta mass [ppm])2    
16948836ITPNLAEFAFSLYR0.5 (delta mass [ppm])2    
16948836ITPNLAEFAFSLYR0.1 (delta mass [ppm])2    
16948836ITPNLAEFAFSLYR0.8 (delta mass [ppm])2    
16316981ITPNLAEFAFSLYR      peptide count: 7
17494094KAVLTIDEKG      
17381150KDTEEEDFHVDQVTTVKV      
17494094KDTEEEDFHVDQVTTVKV      
17381150KFLEDVKK      
17381150KFLENEDRR      
17381150KFLENEDRRS      
17494094KFLENEDRRS      
17494094KFNKPFVFLMIEQNTKS   Oxidation (M)  
17494094KGKWERPFEVKD      
17494094KGTEAAGAMFLEAIPMSIPPEVKF   Oxidation (M)  
17494094KGTEAAGAMFLEAIPMSIPPEVKF   2 Oxidation (M)  
17381150KITPNLAEFAFSLYRQ      
17494094KITPNLAEFAFSLYRQ      
17494094KKLSSWVLLMKY   Oxidation (M)  
17381150KKLYHSEAFTVNFGDTEEAKK      
17494094KKLYHSEAFTVNFGDTEEAKKQ      
17381150KKQINDYVEKG      
17494094KKQINDYVEKG      
17381150KLQHLENELTHDIITKF      
17494094KLQHLENELTHDIITKF      
17381150KLSITGTYDLKS      
17494094KLSITGTYDLKS      
16901338KLSSWVLLMK2   MS2 score: 47 
16709260KLSSWVLLMK0.665445487 (delta mass [ppm])2   MS2 score: 63 
16948836KLSSWVLLMK0.1 (delta mass [ppm])2    
16948836KLSSWVLLMK2.9 (delta mass [ppm])2    
16948836KLSSWVLLMK1.8 (delta mass [ppm])2    
16948836KLSSWVLLMK1 (delta mass [ppm])2    
16948836KLSSWVLLMK0.9 (delta mass [ppm])2    
16948836KLSSWVLLMK1.8 (delta mass [ppm])3    
16948836KLSSWVLLMK2 (delta mass [ppm])2    
16948836KLSSWVLLMK0.2 (delta mass [ppm])2    
16948836KLSSWVLLMK1.5 (delta mass [ppm])2    
17494094KLSSWVLLMKY   Oxidation (M)  
17494094KLVDKFLEDVKK      
17494094KLVDKFLEDVKKL      
16948836KLYHSEAFTVNFGDTEEAK1.1 (delta mass [ppm])3    
17381150KLYHSEAFTVNFGDTEEAKK      
16709260KLYHSEAFTVNFGDTEEAKK-1.117966848 (delta mass [ppm])3   MS2 score: 57 
16948836KLYHSEAFTVNFGDTEEAKK1.7 (delta mass [ppm])4    
16948836KLYHSEAFTVNFGDTEEAKK0.1 (delta mass [ppm])4    
17494094KLYHSEAFTVNFGDTEEAKK      
17381150KLYHSEAFTVNFGDTEEAKKQ      
17494094KLYHSEAFTVNFGDTEEAKKQ      
16709260KQINDYVEK-0.289717933 (delta mass [ppm])2   MS2 score: 41 
16948836KQINDYVEK0.9 (delta mass [ppm])2    
16948836KQINDYVEK1.6 (delta mass [ppm])2    
16948836KQINDYVEK0.7 (delta mass [ppm])2    
16948836KQINDYVEK2.7 (delta mass [ppm])2    
16948836KQINDYVEK2.7 (delta mass [ppm])2    
17381150KQINDYVEKG      
17494094KQINDYVEKG   Pyro-glu (N-term Q)  
17494094KQINDYVEKG      
17494094KQINDYVEKGTQGKI   Pyro-glu (N-term Q)  
17494094KQINDYVEKGTQGKI      
17494094KRLGMFNIQHCKK   Oxidation (M)  
17381150KSPLFMGKV   1Met-ox  
17494094KSPLFMGKV   Oxidation (M)  
17381150KSVLGQLGITKV      
17494094KSVLGQLGITKV      
17381150KTDTSHHDQDHPTFNKI      
17494094KTDTSHHDQDHPTFNKI      
17381150KVFSNGADLSGVTEEAPLKL      
17494094KVFSNGADLSGVTEEAPLKL      
17494094KVVNPTQK      
17381150KWERPFEVKD      
17518487KYLGNATAIFFLPDEGKL1756.89 (expected)     peptide count: 4
16948836LALDNGGLAR0.3 (delta mass [ppm])2    
16948836LDYQEGPPGVEISCWSVEL0 (delta mass [ppm])2    
16709260LGMFNIQHCK-8.02E-04 (delta mass [ppm])2   MS2 score: 43 
16948836LGMFNIQHCK0 (delta mass [ppm])2    
16948836LGMFNIQHCK0.7 (delta mass [ppm])2    
16948836LGMFNIQHCK2.2 (delta mass [ppm])2    
16948836LGMFNIQHCK0.9 (delta mass [ppm])2    
16948836LGMFNIQHCK0.4 (delta mass [ppm])3    
16948836LGMFNIQHCK0 (delta mass [ppm])2    
16901338LQHLENELTHDIITK3   MS2 score: 30 
16709260LQHLENELTHDIITK0.858591614 (delta mass [ppm])2   MS2 score: 60 
16948836LQHLENELTHDIITK0.8 (delta mass [ppm])2    
16948836LQHLENELTHDIITK0.8 (delta mass [ppm])4    
16948836LQHLENELTHDIITK1.8 (delta mass [ppm])2    
16948836LQHLENELTHDIITK0.2 (delta mass [ppm])3    
16948836LQHLENELTHDIITK1.2 (delta mass [ppm])3    
16948836LQHLENELTHDIITK0.9 (delta mass [ppm])2    
16948836LQHLENELTHDIITK0.7 (delta mass [ppm])4    
16948836LQHLENELTHDIITK0.7 (delta mass [ppm])2    
16948836LQHLENELTHDIITK2.4 (delta mass [ppm])2    
16948836LQHLENELTHDIITK3.1 (delta mass [ppm])2    
16948836LQHLENELTHDIITK4.8 (delta mass [ppm])2    
16948836LQHLENELTHDIITK2.2 (delta mass [ppm])3    
16316981LQHLENELTHDIITK      peptide count: 23
16901338LSITGTYDLK-1.30 (delta mass [ppm])2   MS2 score: 36 
16901338LSITGTYDLK2   MS2 score: 58 
16709260LSITGTYDLK0.79938947 (delta mass [ppm])2   MS2 score: 53 
16948836LSITGTYDLK0.9 (delta mass [ppm])2    
16948836LSITGTYDLK0.7 (delta mass [ppm])2    
16948836LSITGTYDLK3 (delta mass [ppm])2    
16948836LSITGTYDLK1 (delta mass [ppm])2    
16948836LSITGTYDLK1.5 (delta mass [ppm])2    
16948836LSITGTYDLK1.1 (delta mass [ppm])2    
16948836LSITGTYDLK0.2 (delta mass [ppm])2    
16948836LSITGTYDLK4.6 (delta mass [ppm])2    
16948836LSITGTYDLK2.6 (delta mass [ppm])2    
16948836LSITGTYDLK1.6 (delta mass [ppm])2    
16948836LSITGTYDLK4.4 (delta mass [ppm])2    
16948836LSITGTYDLK0.3 (delta mass [ppm])2    
16316981LSITGTYDLK      peptide count: 1
16948836LSITGTYDLKSVLGQLGITK4.1 (delta mass [ppm])3    
16901338LSSWVLLMK2   MS2 score: 23 
16709260LSSWVLLMK0.529931875 (delta mass [ppm])2   MS2 score: 63 
16948836LSSWVLLMK0.6 (delta mass [ppm])2    
16948836LSSWVLLMK0.1 (delta mass [ppm])2    
16948836LSSWVLLMK1 (delta mass [ppm])2    
16948836LSSWVLLMK0 (delta mass [ppm])2    
16948836LSSWVLLMK0.1 (delta mass [ppm])2    
16948836LSSWVLLMK0.6 (delta mass [ppm])2    
16948836LSSWVLLMK0.5 (delta mass [ppm])2    
16948836LSSWVLLMK1.2 (delta mass [ppm])2    
16948836LSSWVLLMK1.5 (delta mass [ppm])2    
16948836LSSWVLLMK2.8 (delta mass [ppm])2    
16948836LSSWVLLMK1.3 (delta mass [ppm])2    
16948836LSSWVLLMK0.3 (delta mass [ppm])2    
16709260LVDKFLEDVK1.475922532 (delta mass [ppm])2   MS2 score: 43 
16948836LVDKFLEDVK0 (delta mass [ppm])2    
16316981LVDKFLEDVK      peptide count: 1
16709260LVDKFLEDVKK-0.229597827 (delta mass [ppm])2   MS2 score: 38 
16948836LVDKFLEDVKK1.5 (delta mass [ppm])2    
16948836LVDKFLEDVKK1.9 (delta mass [ppm])2    
16948836LVDKFLEDVKK0.7 (delta mass [ppm])2    
16948836LVDKFLEDVKK0.4 (delta mass [ppm])2    
16316981LVDKFLEDVKK      peptide count: 6
16948836LYHSEAFTVNFGDTEEAK0.4 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAK2.8 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAK2.3 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAK0.3 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAK1.8 (delta mass [ppm])2    
16901338LYHSEAFTVNFGDTEEAKK-0.39 (delta mass [ppm])4   MS2 score: 40 
16901338LYHSEAFTVNFGDTEEAKK3   MS2 score: 47 
16709260LYHSEAFTVNFGDTEEAKK-0.992662504 (delta mass [ppm])4   MS2 score: 43 
16948836LYHSEAFTVNFGDTEEAKK1.7 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAKK2.6 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAKK0.6 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAKK1.7 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAKK2.3 (delta mass [ppm])3    
16948836LYHSEAFTVNFGDTEEAKK3.7 (delta mass [ppm])2    
18004714MIEQNTKSPLFMGKVVNPTQK  22.04 (CE [min])   
16948836NPLVWVHASPEHVVVTR2.1 (delta mass [ppm])2    
16948836NVVFVIDK0.2 (delta mass [ppm])1    
16948836PEQGVEVTGQYER1.1 (delta mass [ppm])2    
16948836QGPVNLLSDPEQGVEVTGQYER2.4 (delta mass [ppm])2    
16709260QINDYVEK-0.378166653 (delta mass [ppm])2   MS2 score: 31 
16948836QINDYVEK0.9 (delta mass [ppm])2    
16948836QINDYVEK1 (delta mass [ppm])2    
16948836QINDYVEK0.6 (delta mass [ppm])2    
16948836QINDYVEK4.7 (delta mass [ppm])2    
16948836QINDYVEK2.6 (delta mass [ppm])2    
16948836QINDYVEK1 (delta mass [ppm])2    
17381150RDTVFALVNYIFFKG      
16948836RLDYQEGPPGVEISCWSVEL1.1 (delta mass [ppm])2    
16948836RLGMFNIQHCK1.3 (delta mass [ppm])3    
16948836RLGMFNIQHCK1.1 (delta mass [ppm])3    
16948836RLGMFNIQHCK1.9 (delta mass [ppm])3    
16948836RLGMFNIQHCK2.4 (delta mass [ppm])3    
17381150RLGMFNIQHCKK   1Met-ox  
17494094RLGMFNIQHCKK      
17494094RLGMFNIQHCKK   Oxidation (M)  
17494094RLGMFNIQHCKKL   Oxidation (M)  
17494094RSASLHLPKL      
17381150RTLNQPDSQLQLTTGNGLFLSEGLKL      
16709260SASLHLPK1.126030817 (delta mass [ppm])2   MS2 score: 53 
16948836SASLHLPK1.4 (delta mass [ppm])2    
16948836SASLHLPK0.3 (delta mass [ppm])2    
16948836SASLHLPK1.7 (delta mass [ppm])2    
16948836SASLHLPK2.6 (delta mass [ppm])2    
16948836SASLHLPK0.4 (delta mass [ppm])2    
16948836SASLHLPK0.9 (delta mass [ppm])2    
16948836SASLHLPK0.8 (delta mass [ppm])2    
16948836SASLHLPK1.1 (delta mass [ppm])2    
16948836SASLHLPK0 (delta mass [ppm])2    
16948836SASLHLPK1 (delta mass [ppm])2    
16948836SASLHLPK1 (delta mass [ppm])2    
16948836SASLHLPK0.5 (delta mass [ppm])2    
16316981SASLHLPK      peptide count: 26
16948836SIQNNVR0.4 (delta mass [ppm])2    
16709260SPLFMGK0.51361457 (delta mass [ppm])2   MS2 score: 35 
16948836SPLFMGK1.1 (delta mass [ppm])1    
16948836SPLFMGK0.6 (delta mass [ppm])2    
16948836SPLFMGK0 (delta mass [ppm])2    
16948836SPLFMGK0.7 (delta mass [ppm])1    
16948836SPLFMGK1.6 (delta mass [ppm])2    
16948836SPLFMGK0.7 (delta mass [ppm])2    
16948836SPLFMGK1.5 (delta mass [ppm])2    
18345293SPLFMGK   28%;38% (HPLC [min or %B])   
16901338SVLGQLGITK-0.48 (delta mass [ppm])2   MS2 score: 48 
16901338SVLGQLGITK2   MS2 score: 48 
16709260SVLGQLGITK0.060121784 (delta mass [ppm])2   MS2 score: 43 
16948836SVLGQLGITK0.2 (delta mass [ppm])2    
16948836SVLGQLGITK0.3 (delta mass [ppm])2    
16948836SVLGQLGITK1 (delta mass [ppm])2    
16948836SVLGQLGITK0.6 (delta mass [ppm])2    
16948836SVLGQLGITK1.5 (delta mass [ppm])2    
16948836SVLGQLGITK0.9 (delta mass [ppm])2    
16948836SVLGQLGITK1.4 (delta mass [ppm])2    
16948836SVLGQLGITK0.7 (delta mass [ppm])2    
16948836SVLGQLGITK1.9 (delta mass [ppm])2    
16948836SVLGQLGITK4.6 (delta mass [ppm])2    
16948836SVLGQLGITK2.7 (delta mass [ppm])2    
16948836SVLGQLGITK1.1 (delta mass [ppm])2    
16948836SVLGQLGITK1.2 (delta mass [ppm])2    
16948836SVLGQLGITK1.2 (delta mass [ppm])2    
16316981SVLGQLGITK      peptide count: 12
16948836SVLGQLGITKVFSNGADLSGVTEEAPLK0.2 (delta mass [ppm])3    
16901338TDTSHHDQDHPTFNK3   MS2 score: 25 
16709260TDTSHHDQDHPTFNK-0.885447875 (delta mass [ppm])2   MS2 score: 44 
16948836TDTSHHDQDHPTFNK1 (delta mass [ppm])2    
16948836TDTSHHDQDHPTFNK0.2 (delta mass [ppm])2    
16948836TDTSHHDQDHPTFNK0.3 (delta mass [ppm])3    
16948836TDTSHHDQDHPTFNK2.2 (delta mass [ppm])2    
16948836TDTSHHDQDHPTFNK0.9 (delta mass [ppm])2    
16948836TDTSHHDQDHPTFNK3.4 (delta mass [ppm])2    
16316981TDTSHHDQDHPTFNK      peptide count: 6
16948836TGLLLLSD1 (delta mass [ppm])1    
16948836TGLLLLSDPDK2.9 (delta mass [ppm])2    
16948836TGLLLLSDPDKVTIGLLFWDGR2.1 (delta mass [ppm])3    
16901338TLNQPDSQLQLTTGNGLFLSEGLK3   MS2 score: 43 
16709260TLNQPDSQLQLTTGNGLFLSEGLK-1.859067152 (delta mass [ppm])2   MS2 score: 107 
16948836TLNQPDSQLQLTTGNGLFLSEGLK0.9 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK2.5 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK1.9 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK2.5 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK1 (delta mass [ppm])3    
16948836TLNQPDSQLQLTTGNGLFLSEGLK2 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK2.2 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK0.5 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK0.2 (delta mass [ppm])2    
16948836TLNQPDSQLQLTTGNGLFLSEGLK1.5 (delta mass [ppm])3    
16316981TLNQPDSQLQLTTGNGLFLSEGLK      peptide count: 44
16901338VFSNGADLSGVTEEAPLK2   MS2 score: 92 
16709260VFSNGADLSGVTEEAPLK-0.969518758 (delta mass [ppm])2   MS2 score: 131 
16948836VFSNGADLSGVTEEAPLK2.6 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK2.1 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK1.8 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK2.4 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK2.5 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK0.4 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK0.4 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK0.9 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK2.7 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK3.6 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK1.5 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK0.4 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK1.6 (delta mass [ppm])2    
16948836VFSNGADLSGVTEEAPLK3.1 (delta mass [ppm])2    
16316981VFSNGADLSGVTEEAPLK      peptide count: 9
16709260VFSNGADLSGVTEEAPLKLSK2.265485094 (delta mass [ppm])3   MS2 score: 36 
16948836VFSNGADLSGVTEEAPLKLSK1 (delta mass [ppm])3    
16948836VFSNGADLSGVTEEAPLKLSK1.4 (delta mass [ppm])3    
16316981VFSNGADLSGVTEEAPLKLSK      peptide count: 2
16948836VQGNDHSATR0.6 (delta mass [ppm])2    
16948836VTIGLLFWDGR0.2 (delta mass [ppm])2    
16709260VVNPTQK1.085226884 (delta mass [ppm])2   MS2 score: 27 
16948836VVNPTQK2.4 (delta mass [ppm])1    
16948836VVNPTQK0.3 (delta mass [ppm])1    
16948836VVNPTQK0.3 (delta mass [ppm])1    
16948836VVNPTQK2.4 (delta mass [ppm])2    
16948836VVNPTQK1 (delta mass [ppm])2    
16948836VVNPTQK2 (delta mass [ppm])2    
16948836WERPFEVK0.8 (delta mass [ppm])2    
16709260WERPFEVKDTEEEDFHVDQVTTVK-1.121051108 (delta mass [ppm])4   MS2 score: 53 
16948836WKETLFSVMPGLK1.9 (delta mass [ppm])2    
16948836YLGNATAIFFLPDEGK0.3 (delta mass [ppm])2    
16684767ADLSGVTEEAPLKL 2    
16684767AIFFLPDEGKLQHLENELTHDIITKF 3    
16684767DTHDEILEGLNFN#LTEIPEAQIHEGFQELLRT 3    
16684767FFLPDEGKLQHLENELTHDIITKF 2    
16684767FSNGADLSGVTEEAPLKL 2    
16684767FSNGADLSGVTEEAPLKLSKA 2    
16684767FTVNFGDTEEAKKQ 2    
16684767GDAAQKTDTSHHDQDHPTFNKI 2    
16684767IFFLPDEGKLQHLENELTHDIITKF 2    
16684767KADTHDEILEGLNFN#LTEIPEAQI 2    
16684767KADTHDEILEGLNFN#LTEIPEAQIHE 3    
16684767KADTHDEILEGLNFN#LTEIPEAQIHEGFQE 2    
16684767KADTHDEILEGLNFN#LTEIPEAQIHEGFQELLRT 2    
16684767KAVLTIDEKGTEAAGAM*FLEAIPM*SIPPEVKF 2    
16684767KAVLTIDEKGTEAAGAMFLEAIPM*SIPPEVKF 2    
16684767KAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKF 2    
16684767KDTEEEDFHVDQVTTVKV 1    
16684767KDTEEEDFHVDQVTTVKVPMMKR 2    
16684767KELDRDTVFALVNYIFFKG 2    
16684767KFLEDVKKL 1    
16684767KFLENEDRR 1    
16684767KFNKPFVFLM*IEQNTKS 2    
16684767KFNKPFVFLM*IEQNTKSPLFM*GKV 3    
16684767KFNKPFVFLMIEQNT 2    
16684767KFNKPFVFLMIEQNTKS 1    
16684767KFNKPFVFLMIEQNTKSPLFM*GKV 3    
16684767KGKWERPFEVKD 2    
16684767KGKWERPFEVKDTEEEDFHVDQVTTVKV 2    
16684767KGTEAAGAM*FLEAIPM*S 2    
16684767KGTEAAGAM*FLEAIPM*SIPPEVKF 2    
16684767KGTEAAGAM*FLEAIPMSIPPEVKF 2    
16684767KGTEAAGAMFLEAIPM*S 2    
16684767KGTEAAGAMFLEAIPM*SIPPEVKF 2    
16684767KGTEAAGAMFLEAIPMSIPPEVKF 2    
16684767KITPNLAEFAFSLYRQ 1    
16684767KIVDLVKELDRD 2    
16684767KKLSSWVLLM*KY 1    
16684767KKLSSWVLLMKY 1    
16684767KKLYHSEAFTVNFGDTEEAKKQ 2    
16684767KKQINDYVEKG 1    
16684767KKQINDYVEKGTQGKI 2    
16684767KLQHLENELTHDIITKF 1    
16684767KLSITGTYDLKS 1    
16684767KLSSWVLLMKY 2    
16684767KLVDKFLEDVKK 1    
16684767KLVDKFLEDVKKL 1    
16684767KLYHSEAFTVNFGDTEEAKK 2    
16684767KLYHSEAFTVNFGDTEEAKKQ 2    
16684767KLYHSEAFTVNFGDTEEAKKQINDYVEKG 2    
16684767KQINDYVEKG 1    
16684767KQINDYVEKGTQGKI 1    
16684767KRLGMFNIQHCKK 2    
16684767KSPLFMGKV 1    
16684767KSVLGQLGITKV 1    
16684767KTDTSHHDQDHPTFNKI 1    
16684767KTDTSHHDQDHPTFNKITPNLAEFAFSLYRQ 2    
16684767KVFSNGADLSGVTEEAPLKL 1    
16684767KVFSNGADLSGVTEEAPLKLS 2    
16684767KVFSNGADLSGVTEEAPLKLSKA 2    
16684767KVFSNGADLSGVTEEAPLKLSKAVHKA 2    
16684767KVVNPTQK- 1    
16684767KWERPFEVKDTEEEDFHVDQVTTVKV 2    
16684767KYLGN#ATAIFFLPDEGKL 1    
16684767KYLGN#ATAIFFLPDEGKLQH 1    
16684767KYLGN#ATAIFFLPDEGKLQHLENE 2    
16684767KYLGN#ATAIFFLPDEGKLQHLENELTHDI 3    
16684767KYLGN#ATAIFFLPDEGKLQHLENELTHDIITKF 2    
16684767LGN#ATAIFFLPDEGKLQHLENELTHDIITKF 3    
16684767MKYLGN#ATAIFFLPDEGKL 2    
16684767NFN#LTEIPEAQIHEGFQELLRT 2    
16684767NGADLSGVTEEAPLKLSKA 2    
16684767NKITPNLAEFAFSLYRQ 2    
16684767NLAEFAFSLYRQ 2    
16684767RDTVFALVNYIFFKG 1    
16684767RLGM*FNIQHCKK 1    
16684767RLGM*FNIQHCKKL 2    
16684767RLGMFNIQHCKK 1    
16684767RLGMFNIQHCKKL 2    
16684767RPFEVKDTEEEDFHVDQVTTVKV 2    
16684767RQLAHQSN#STNIFFSPVSIATAFA 2    
16684767RQLAHQSN#STNIFFSPVSIATAFAM*LSLGTKA 2    
16684767RQLAHQSN#STNIFFSPVSIATAFAMLSLGTKA 2    
16684767RSASLHLPKL 1    
16684767RTLNQPDSQLQLTTGNG 1    
16684767RTLNQPDSQLQLTTGNGLFLSEGLKL 2    
16684767RTLNQPDSQLQLTTGNGLFLSEGLKLVDKF 3    
16684767RTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKK 3    
16684767RTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKL 3    
16684767TPNLAEFAFSLYRQ 2    
16684767VFSNGADLSGVTEEAPLKLSKA 2    
16684767YLGN#ATAIFFLPDEGKLQHLENELTHDIITKF 3    
18361515F.TVNFGDTEEAK.K1210.36 (observed)1    
18361515K.ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR.T1231.58 (observed)3    
18361515K.AVLTIDEK.G888.5 (observed)1    
18361515K.AVLTIDEK.G2   peptide delta score: 44.51 
18361515K.AVLTIDEK.G2   peptide delta score: 44.51 
18361515K.DTEEEDFHVDQV.T1462.6 (observed)1    
18361515K.DTEEEDFHVDQVTTVK.V946.03 (observed)2    
18361515K.DTEEEDFHVDQVTTVK.V631.6 (observed)3    
18361515K.DTEEEDFHVDQVTTVK.V946.3 (observed)2    
18361515K.ELDRDTVFALVNYIFFK.G697.13 (observed)3    
18361515K.ELDRDTVFALVNYIFFK.G1046.56 (observed)2    
18361515K.ELDRDTVFALVNYIFFK.G696.7 (observed)3    
18361515K.ELDRDTVFALVNYIFFK.G1045.55 (observed)2    
18361515K.ELDRDTVFALVNYIFFKG.K1073.04 (observed)2    
18361515K.FLEDVKK.L439.41 (observed)2    
18361515K.FNKPFVFLMIEQNTK.S619.11 (observed)3    
18361515K.FNKPFVFLMIEQNTK.S929.16 (observed)2    
18361515K.FNKPFVFLMIEQNTK.S618.66 (observed)3    
18361515K.FNKPFVFLMIEQNTK.S927.99 (observed)2    
18361515K.GKWERPFEVK.D639.53 (observed)2    
18361515K.GKWERPFEVK.D638.03 (observed)2    
18361515K.GKWERPFEVKDTEEEDFHVDQVTTVK.V1049.6 (observed)3    
18361515K.GTEAAGAMFLEAIPMSIPPEVK.F1130.08 (observed)2    
18361515K.IVDLVKELDRDTVFALVNYIFFK.G919.17 (observed)3    
18361515K.KLSSWVLLMK.Y602.88 (observed)2    
18361515K.KLSSWVLLMK.Y602.36 (observed)2    
18361515K.KLYHSEAFTVNFGDTEEAK.K1094.75 (observed)2    
18361515K.KLYHSEAFTVNFGDTEEAKK.Q771.37 (observed)3    
18361515K.KLYHSEAFTVNFGDTEEAKK.Q1157.09 (observed)2    
18361515K.KQINDYVEK.G569.4 (observed)2    
18361515K.LQHLENELTHDIITK.F902.12 (observed)2    
18361515K.LQHLENELTHDIITK.F602.1 (observed)3    
18361515K.LQHLENELTHDIITK.F902.81 (observed)2    
18361515K.LQHLENELTHDIITK.F601.89 (observed)3    
18361515K.LSITGTYDLK.S555.3 (observed)2    
18361515K.LSITGTYDLK.S555.3 (observed)2    
18361515K.LSSWVLLMK.Y538.31 (observed)2    
18361515K.LVDKFLEDVKK.L444.59 (observed)3    
18361515K.LVDKFLEDVKK.L667.13 (observed)2    
18361515K.LYHSEAFTVNFGDTEEAK.K1029.16 (observed)2    
18361515K.LYHSEAFTVNFGDTEEAKK.Q1093.13 (observed)2    
18361515K.LYHSEAFTVNFGDTEEAKK.Q729.16 (observed)3    
18361515K.LYHSEAFTVNFGDTEEAKK.Q1092.76 (observed)2    
18361515K.LYHSEAFTVNFGDTEEAKK.Q729.15 (observed)3    
18361515K.QINDYVEK.G504.75 (observed)2    
18361515K.QINDYVEK.G2  Pyro-glu (N-term Q)peptide delta score: 47.53 
18361515K.RLGMFNIQHCK.K701.88 (observed)2    
18361515K.SPLFMGK.V781.83 (observed)1    
18361515K.SPLFMGKVVNPTQK.-772.75 (observed)2    
18361515K.SVLGQLGITK.V508.1 (observed)2    
18361515K.SVLGQLGITK.V1016.24 (observed)1    
18361515K.SVLGQLGITK.V508.49 (observed)2    
18361515K.SVLGQLGITK.V2   peptide delta score: 44.84 
18361515K.SVLGQLGITK.V2   peptide delta score: 44.84 
18361515K.TDTSHHDQDHPTFNK.I593.37 (observed)3    
18361515K.TDTSHHDQDHPTFNK.I1781.77 (observed)1    
18361515K.TDTSHHDQDHPTFNK.I891.39 (observed)2    
18361515K.TDTSHHDQDHPTFNK.I890.67 (observed)2    
18361515K.TDTSHHDQDHPTFNK.I593.97 (observed)3    
18361515K.VFSNGADLSGVTEEAPLK.L1833.92 (observed)1    
18361515K.VFSNGADLSGVTEEAPLK.L917.19 (observed)2    
18361515K.VFSNGADLSGVTEEAPLK.L917.47 (observed)2    
18361515K.VFSNGADLSGVTEEAPLKLSK.A720.78 (observed)3    
18361515K.VFSNGADLSGVTEEAPLKLSK.A1081.21 (observed)2    
18361515K.WERPFEVK.D545.49 (observed)2    
18361515K.YLGNATAIFFLPDEGK.L878.63 (observed)2    
18361515L.GMFNIQHCK.K567.26 (observed)2    
18361515R.LGMFNIQH.C479.74 (observed)2    
18361515R.LGMFNIQHCK.K1249.61 (observed)1    
18361515R.LGMFNIQHCK.K625.53 (observed)2    
18361515R.LGMFNIQHCK.K624.2 (observed)2    
18361515R.SASLHLPK.L426.38 (observed)2    
18361515R.SASLHLPK.L426.49 (observed)2    
18361515R.TLNQPDSQLQLTTGNGLFLSEGLK.L1287.91 (observed)2    
18361515R.TLNQPDSQLQLTTGNGLFLSEGLK.L858.7 (observed)3    
18361515R.TLNQPDSQLQLTTGNGLFLSEGLK.L1287.86 (observed)2    
18361515R.TLNQPDSQLQLTTGNGLFLSEGLK.L858.71 (observed)3    
18361515T.DTSHHDQDHPTFNK.I839.36 (observed)2    
18361515K.AVLTIDEKGTEAAGAMFLEAIPMSIPPEVK.F1043.6 (observed)3   peptide delta score: 45.59 
18361515K.FNKPFVFLMIEQNTK.S619.35 (observed)3   peptide delta score: 25.67 
18361515K.FNKPFVFLMIEQNTK.S619.35 (observed)3   peptide delta score: 37.45 
18361515K.FNKPFVFLMIEQNTK.S619.36 (observed)3   peptide delta score: 31.48 
18361515K.FNKPFVFLMIEQNTK.S619.36 (observed)3   peptide delta score: 24.3 
18361515K.FNKPFVFLMIEQNTK.S619.37 (observed)3   peptide delta score: 36.83 
18361515K.FNKPFVFLMIEQNTK.S624.68 (observed)3  Oxidation (M)peptide delta score: 45.06 
18361515K.FNKPFVFLMIEQNTK.S624.68 (observed)3  Oxidation (M)peptide delta score: 45.06 
18361515K.FNKPFVFLMIEQNTK.S624.68 (observed)3   peptide delta score: 22.98 
18361515K.FNKPFVFLMIEQNTK.S624.7 (observed)3   peptide delta score: 24.86 
18361515K.FNKPFVFLMIEQNTK.S619.39 (observed)3   peptide delta score: 21.83 
18361515K.FNKPFVFLMIEQNTK.S619.37 (observed)3   peptide delta score: 26.42 
18361515K.FNKPFVFLMIEQNTKSPLFMGK.V654.88 (observed)4   peptide delta score: 20.82 
18361515K.FNKPFVFLMIEQNTKSPLFMGK.V654.88 (observed)4   peptide delta score: 21.58 
18361515K.FNKPFVFLMIEQNTKSPLFMGK.V654.9 (observed)4   peptide delta score: 32.63 
18361515K.GTEAAGAMFLEAIPMSIPPEVK.F753.75 (observed)3   peptide delta score: 45.19 
18361515K.LSITGTYDLK.S555.82 (observed)2   peptide delta score: 72.36 
18361515K.LSITGTYDLK.S555.83 (observed)2   peptide delta score: 57.81 
18361515K.LSITGTYDLK.S555.83 (observed)2   peptide delta score: 52.95 
18361515K.LSITGTYDLK.S555.86 (observed)2   peptide delta score: 58.73 
18361515K.LSITGTYDLK.S555.83 (observed)2   peptide delta score: 58.99 
18361515K.LSSWVLLMK.Y538.86 (observed)2   peptide delta score: 40.2 
18361515K.QINDYVEKGTQGK.I493.95 (observed)3   peptide delta score: 30.94 
18361515K.RLGMFNIQHCK.K482.6 (observed)3   peptide delta score: 23.51 
18361515K.RLGMFNIQHCK.K482.61 (observed)3  NIPCAM (C)peptide delta score: 35.69 
18361515K.RLGMFNIQHCK.K482.61 (observed)3  NIPCAM (C)peptide delta score: 35.69 
18361515K.RLGMFNIQHCK.K482.61 (observed)3   peptide delta score: 21.29 
18361515K.SPLFMGK.V390.25 (observed)2   peptide delta score: 21.29 
18361515K.SPLFMGK.V390.22 (observed)2   peptide delta score: 21.48 
18361515K.SPLFMGK.V390.23 (observed)2   peptide delta score: 35.8 
18361515K.SVLGQLGITK.V508.33 (observed)2   peptide delta score: 23.65 
18361515K.SVLGQLGITK.V508.34 (observed)2   peptide delta score: 20.48 
18361515K.SVLGQLGITK.V508.36 (observed)2   peptide delta score: 38.86 
18361515K.SVLGQLGITK.V508.32 (observed)2   peptide delta score: 61.96 
18361515K.SVLGQLGITK.V508.32 (observed)2   peptide delta score: 38.45 
18361515K.SVLGQLGITK.V508.34 (observed)2   peptide delta score: 26.34 
18361515K.SVLGQLGITK.V508.28 (observed)2   peptide delta score: 69.78 
18361515K.SVLGQLGITK.V508.27 (observed)2   peptide delta score: 39.61 
18361515K.SVLGQLGITK.V508.36 (observed)2   peptide delta score: 64.76 
18361515K.SVLGQLGITK.V508.34 (observed)2   peptide delta score: 46.14 
18361515K.VFSNGADLSGVTEEAPLK.L917.52 (observed)2   peptide delta score: 26.87 
18361515K.VFSNGADLSGVTEEAPLKLSK.A721.4 (observed)3   peptide delta score: 63.86 
18361515R.LGMFNIQHCK.K430.57 (observed)3  NIPCAM (C)peptide delta score: 39.61 
18361515R.LGMFNIQHCK.K430.57 (observed)3  NIPCAM (C)peptide delta score: 39.61 
18361515R.LGMFNIQHCK.K430.57 (observed)3   peptide delta score: 43.29 
18361515R.LGMFNIQHCK.K430.58 (observed)3  NIPCAM (C)peptide delta score: 43.41 
18361515R.LGMFNIQHCKK.L473.27 (observed)3  NIPCAM (C)peptide delta score: 30.25 
18361515R.LGMFNIQHCKK.L473.27 (observed)3  NIPCAM (C)peptide delta score: 30.25 
18361515R.LGMFNIQHCKK.L473.27 (observed)3  NIPCAM (C)peptide delta score: 30.25 
18361515R.LGMFNIQHCKK.L473.27 (observed)3   peptide delta score: 29.82 
18361515R.LGMFNIQHCKK.L473.27 (observed)3   peptide delta score: 32.23 
18361515R.SASLHLPK.L426.78 (observed)2   peptide delta score: 28.87 
18361515K.AVLTIDEK.G444.71 (observed)2   peptide delta score: 48.33 
18361515K.AVLTIDEK.G444.79 (observed)2   peptide delta score: 33.77 
18361515K.GTEAAGAMFLEAIPMSIPPEVK.F753.64 (observed)3   peptide delta score: 26 
18361515K.KLSSWVLLMK.Y402.21 (observed)3   peptide delta score: 32.67 
18361515K.KLSSWVLLMK.Y402.21 (observed)3   peptide delta score: 27.42 
18361515K.LSITGTYDLK.S555.74 (observed)2   peptide delta score: 30.64 
18361515K.LSITGTYDLK.S555.75 (observed)2   peptide delta score: 57.84 
18361515K.LSITGTYDLK.S555.75 (observed)2   peptide delta score: 71.97 
18361515K.LSITGTYDLK.S555.75 (observed)2   peptide delta score: 50.67 
18361515K.LSITGTYDLK.S555.76 (observed)2   peptide delta score: 45.7 
18361515K.LSITGTYDLK.S555.76 (observed)2   peptide delta score: 72.22 
18361515K.LSITGTYDLK.S555.77 (observed)2   peptide delta score: 41.98 
18361515K.LSITGTYDLK.S555.84 (observed)2   peptide delta score: 33.02 
18361515K.LSITGTYDLK.S555.82 (observed)2   peptide delta score: 45.62 
18361515K.LSSWVLLMK.Y538.75 (observed)2   peptide delta score: 71.3 
18361515K.QINDYVEK.G504.71 (observed)2   peptide delta score: 38.43 
18361515K.QINDYVEK.G504.7 (observed)2   peptide delta score: 21.94 
18361515K.QINDYVEK.G504.79 (observed)2   peptide delta score: 39.14 
18361515K.QINDYVEK.G504.77 (observed)2   peptide delta score: 44.1 
18361515K.SPLFMGK.V390.17 (observed)2   peptide delta score: 40.11 
18361515K.SVLGQLGITK.V508.24 (observed)2   peptide delta score: 50.94 
18361515K.SVLGQLGITK.V508.26 (observed)2   peptide delta score: 48.12 
18361515K.SVLGQLGITK.V508.4 (observed)2   peptide delta score: 43.15 
18361515K.SVLGQLGITK.V508.33 (observed)2   peptide delta score: 45.31 
18361515K.VFSNGADLSGVTEEAPLK.L917.34 (observed)2   peptide delta score: 118.3 
18361515R.SASLHLPK.L426.72 (observed)2   peptide delta score: 44.14 
18361515R.TLNQPDSQLQLTTGNGLFLSEGLK.L858.7 (observed)3   peptide delta score: 67.17 
15253431TLNQPDSQLQLTTGNGLFLSEGLK 3   Pept_E (Sonar search): 4.50E-03 
15253431VFSNGADLSGVTEEAPLK 2   Pept_E (Sonar search): 1.10E-02 
18578523QINDYVEK2   
18578523QINDYVEK2   
21127740DTEEEDFHVDQVTTVK946.43 (observed)24.33E+0517.29 (HPLC [min or %B]) MS2 score: 73.92
21127740DTEEEDFHVDQVTTVK946.43 (observed)27.11E+0517.75 (HPLC [min or %B]) MS2 score: 71.56
21127740DTEEEDFHVDQVTTVK631.29 (observed)37.50E+0618.7 (HPLC [min or %B]) MS2 score: 39.39
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.24E+0618.75 (HPLC [min or %B]) MS2 score: 76.1
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.18E+0517.63 (HPLC [min or %B]) MS2 score: 57.73
21127740DTEEEDFHVDQVTTVK631.29 (observed)31.61E+0618.53 (HPLC [min or %B]) MS2 score: 40.2
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.63E+0514.81 (HPLC [min or %B]) MS2 score: 55.35
21127740DTEEEDFHVDQVTTVK631.29 (observed)37.94E+0515.75 (HPLC [min or %B]) MS2 score: 26.9
21127740DTEEEDFHVDQVTTVK946.43 (observed)25.90E+0515.95 (HPLC [min or %B]) MS2 score: 62.29
21127740DTEEEDFHVDQVTTVK631.29 (observed)31.34E+0616.8 (HPLC [min or %B]) MS2 score: 51.69
21127740DTEEEDFHVDQVTTVK631.29 (observed)31.77E+0617.82 (HPLC [min or %B]) MS2 score: 30.69
21127740DTEEEDFHVDQVTTVK946.43 (observed)27.73E+0518 (HPLC [min or %B]) MS2 score: 95.23
21127740DTEEEDFHVDQVTTVK946.43 (observed)29.65E+0418.74 (HPLC [min or %B]) MS2 score: 41.92
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.33E+0517.36 (HPLC [min or %B]) MS2 score: 32.33
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.07E+0518.41 (HPLC [min or %B]) MS2 score: 40.44
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.02E+0517.44 (HPLC [min or %B]) MS2 score: 54.73
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.21E+0518 (HPLC [min or %B]) MS2 score: 32.52
21127740DTEEEDFHVDQVTTVK946.43 (observed)29.68E+0419.86 (HPLC [min or %B]) MS2 score: 39
21127740DTEEEDFHVDQVTTVK631.29 (observed)33.36E+0518.19 (HPLC [min or %B]) MS2 score: 30.69
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.66E+0518.22 (HPLC [min or %B]) MS2 score: 73.96
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.58E+0519.23 (HPLC [min or %B]) MS2 score: 48.58
21127740DTEEEDFHVDQVTTVK631.29 (observed)34.51E+0618.86 (HPLC [min or %B]) MS2 score: 42.48
21127740DTEEEDFHVDQVTTVK946.43 (observed)22.33E+0618.97 (HPLC [min or %B]) MS2 score: 74.63
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.47E+0516.05 (HPLC [min or %B]) MS2 score: 38.64
21127740DTEEEDFHVDQVTTVK631.29 (observed)33.45E+0517.68 (HPLC [min or %B]) MS2 score: 35.07
21127740DTEEEDFHVDQVTTVK946.43 (observed)22.53E+0519.2 (HPLC [min or %B]) MS2 score: 75.78
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.22E+0519.19 (HPLC [min or %B]) MS2 score: 34.95
21127740DTVFALVNYIFFK788.92 (observed)22.37E+0648.56 (HPLC [min or %B]) MS2 score: 65.12
21127740DTVFALVNYIFFK526.29 (observed)34.33E+0548.65 (HPLC [min or %B]) MS2 score: 48.45
21127740DTVFALVNYIFFK526.29 (observed)31.53E+0648.34 (HPLC [min or %B]) MS2 score: 49.5
21127740DTVFALVNYIFFK788.92 (observed)25.87E+0548.07 (HPLC [min or %B]) MS2 score: 65.59
21127740DTVFALVNYIFFK788.93 (observed)21.59E+0648.28 (HPLC [min or %B]) MS2 score: 62.32
21127740DTVFALVNYIFFK526.29 (observed)37.34E+0548.43 (HPLC [min or %B]) MS2 score: 57
21127740DTVFALVNYIFFK789.42 (observed)21.60E+0540.94 (HPLC [min or %B])Deamidation (NQ)MS2 score: 35.09
21127740DTVFALVNYIFFK788.93 (observed)22.93E+0548.05 (HPLC [min or %B]) MS2 score: 49.64
21127740DTVFALVNYIFFK526.28 (observed)31.88E+0548.19 (HPLC [min or %B]) MS2 score: 38.17
21127740DTVFALVNYIFFK788.93 (observed)22.55E+0548.28 (HPLC [min or %B]) MS2 score: 46.08
21127740DTVFALVNYIFFK788.93 (observed)21.58E+0548.12 (HPLC [min or %B]) MS2 score: 45.17
21127740DTVFALVNYIFFK526.29 (observed)35.62E+0448.26 (HPLC [min or %B]) MS2 score: 23.28
21127740DTVFALVNYIFFK788.93 (observed)24.38E+0548.56 (HPLC [min or %B]) MS2 score: 42.93
21127740DTVFALVNYIFFK788.93 (observed)23.04E+0548.54 (HPLC [min or %B]) MS2 score: 55.82
21127740DTVFALVNYIFFK788.92 (observed)22.13E+0548.37 (HPLC [min or %B]) MS2 score: 40.07
21127740DTVFALVNYIFFK788.92 (observed)29.73E+0548.46 (HPLC [min or %B]) MS2 score: 46.89
21127740DTVFALVNYIFFK788.92 (observed)21.25E+0548.28 (HPLC [min or %B]) MS2 score: 32.65
21127740DTVFALVNYIFFK788.92 (observed)24.46E+0548.62 (HPLC [min or %B]) MS2 score: 45.93
21127740DTVFALVNYIFFK788.92 (observed)23.16E+0548.08 (HPLC [min or %B]) MS2 score: 62.04
21127740DTVFALVNYIFFK788.92 (observed)21.73E+0548.01 (HPLC [min or %B]) MS2 score: 44.61
21127740DTVFALVNYIFFK788.92 (observed)29.82E+0448.55 (HPLC [min or %B]) MS2 score: 49.38
21127740DTVFALVNYIFFK788.93 (observed)21.33E+0548.15 (HPLC [min or %B]) MS2 score: 40.73
21127740DTVFALVNYIFFK788.92 (observed)29.34E+0447.95 (HPLC [min or %B]) MS2 score: 32.3
21127740DTVFALVNYIFFK788.92 (observed)22.20E+0548.26 (HPLC [min or %B]) MS2 score: 45.1
21127740DTVFALVNYIFFK788.93 (observed)25.89E+0548.32 (HPLC [min or %B]) MS2 score: 73.94
21127740DTVFALVNYIFFK788.93 (observed)21.21E+0548.18 (HPLC [min or %B]) MS2 score: 45.51
21127740DTVFALVNYIFFK788.92 (observed)21.63E+0548.23 (HPLC [min or %B]) MS2 score: 54.72
21127740DTVFALVNYIFFK788.92 (observed)22.47E+0548.23 (HPLC [min or %B]) MS2 score: 58.09
21127740ITPNLAEFAFSLYR821.44 (observed)21.80E+0643.26 (HPLC [min or %B]) MS2 score: 88.32
21127740ITPNLAEFAFSLYR547.96 (observed)32.99E+0543.36 (HPLC [min or %B]) MS2 score: 32.98
21127740ITPNLAEFAFSLYR547.96 (observed)31.66E+0643.13 (HPLC [min or %B]) MS2 score: 62.86
21127740ITPNLAEFAFSLYR821.44 (observed)22.10E+0643.71 (HPLC [min or %B]) MS2 score: 88.61
21127740ITPNLAEFAFSLYR547.96 (observed)36.41E+0543.82 (HPLC [min or %B]) MS2 score: 49.9
21127740ITPNLAEFAFSLYR821.44 (observed)26.74E+0543.52 (HPLC [min or %B]) MS2 score: 71.36
21127740ITPNLAEFAFSLYR821.44 (observed)28.53E+0543.37 (HPLC [min or %B]) MS2 score: 80.77
21127740ITPNLAEFAFSLYR821.44 (observed)26.62E+0543.84 (HPLC [min or %B]) MS2 score: 68.52
21127740ITPNLAEFAFSLYR821.44 (observed)21.35E+0643.26 (HPLC [min or %B]) MS2 score: 43.66
21127740ITPNLAEFAFSLYR547.96 (observed)34.04E+0543.3 (HPLC [min or %B]) MS2 score: 53.32
21127740ITPNLAEFAFSLYR821.43 (observed)22.98E+0643.24 (HPLC [min or %B]) MS2 score: 55.81
21127740ITPNLAEFAFSLYR547.96 (observed)37.75E+0543.28 (HPLC [min or %B]) MS2 score: 60.45
21127740ITPNLAEFAFSLYR547.96 (observed)31.88E+0543.13 (HPLC [min or %B]) MS2 score: 45.88
21127740ITPNLAEFAFSLYR821.44 (observed)21.37E+0544.31 (HPLC [min or %B]) MS2 score: 38.15
21127740LQHLENELTHDIITK451.74 (observed)45.03E+0521.76 (HPLC [min or %B]) MS2 score: 25.88
21127740LQHLENELTHDIITK902.48 (observed)25.72E+0521.55 (HPLC [min or %B]) MS2 score: 63.43
21127740LQHLENELTHDIITK451.75 (observed)47.73E+0521.78 (HPLC [min or %B]) MS2 score: 33.81
21127740LQHLENELTHDIITK902.49 (observed)23.71E+0521.79 (HPLC [min or %B]) MS2 score: 43.81
21127740LQHLENELTHDIITK902.48 (observed)21.13E+0621.53 (HPLC [min or %B]) MS2 score: 68.71
21127740LQHLENELTHDIITK451.75 (observed)41.30E+0721.73 (HPLC [min or %B]) MS2 score: 34.19
21127740LQHLENELTHDIITK451.75 (observed)44.33E+0721.23 (HPLC [min or %B]) MS2 score: 28.61
21127740LQHLENELTHDIITK451.75 (observed)43.57E+0621.5 (HPLC [min or %B]) MS2 score: 31.33
21127740LQHLENELTHDIITK902.48 (observed)21.76E+0621.73 (HPLC [min or %B]) MS2 score: 63.52
21127740LQHLENELTHDIITK451.75 (observed)41.74E+0721.86 (HPLC [min or %B]) MS2 score: 30.92
21127740LQHLENELTHDIITK902.48 (observed)26.35E+0621.49 (HPLC [min or %B]) MS2 score: 64.25
21127740LQHLENELTHDIITK451.75 (observed)46.90E+0620.68 (HPLC [min or %B]) MS2 score: 28.67
21127740LQHLENELTHDIITK451.74 (observed)47.46E+0524.63 (HPLC [min or %B]) MS2 score: 26.74
21127740LQHLENELTHDIITK451.75 (observed)43.50E+0721.38 (HPLC [min or %B]) MS2 score: 24.9
21127740LQHLENELTHDIITK451.75 (observed)44.80E+0521.76 (HPLC [min or %B]) MS2 score: 39.2
21127740LQHLENELTHDIITK451.75 (observed)41.33E+0521.73 (HPLC [min or %B]) MS2 score: 26.11
21127740LQHLENELTHDIITK902.49 (observed)21.64E+0521.8 (HPLC [min or %B]) MS2 score: 36.56
21127740LSITGTYDLK555.81 (observed)25.97E+0421.93 (HPLC [min or %B]) MS2 score: 54.85
21127740LSITGTYDLK555.81 (observed)21.78E+0521.68 (HPLC [min or %B]) MS2 score: 51.3
21127740LSITGTYDLK555.81 (observed)22.36E+0621.13 (HPLC [min or %B]) MS2 score: 49.36
21127740LSITGTYDLK555.81 (observed)22.04E+0521.45 (HPLC [min or %B]) MS2 score: 37.86
21127740LSITGTYDLK555.81 (observed)25.55E+0521.77 (HPLC [min or %B]) MS2 score: 51.2
21127740LSITGTYDLK555.8 (observed)28.76E+0521.69 (HPLC [min or %B]) MS2 score: 52.73
21127740LSITGTYDLK555.81 (observed)21.08E+0625.59 (HPLC [min or %B]) MS2 score: 55.54
21127740LSITGTYDLK555.81 (observed)21.62E+0620.92 (HPLC [min or %B]) MS2 score: 54.53
21127740LSITGTYDLK555.81 (observed)21.37E+0622 (HPLC [min or %B]) MS2 score: 27.06
21127740LSITGTYDLK555.81 (observed)22.56E+0625.25 (HPLC [min or %B]) MS2 score: 52.36
21127740LSITGTYDLK555.81 (observed)23.40E+0521.57 (HPLC [min or %B]) MS2 score: 58.93
21127740LSITGTYDLK555.81 (observed)26.01E+0621.79 (HPLC [min or %B]) MS2 score: 53.21
21127740LSITGTYDLK555.81 (observed)24.94E+0621.61 (HPLC [min or %B]) MS2 score: 54.86
21127740LSITGTYDLK555.81 (observed)24.20E+0621.96 (HPLC [min or %B]) MS2 score: 52.74
21127740LSITGTYDLK555.81 (observed)22.63E+0521.89 (HPLC [min or %B]) MS2 score: 47.28
21127740LSITGTYDLK555.81 (observed)22.50E+0521.31 (HPLC [min or %B]) MS2 score: 42.81
21127740LSITGTYDLK555.81 (observed)21.61E+0621.41 (HPLC [min or %B]) MS2 score: 50.69
21127740LSITGTYDLK555.81 (observed)21.72E+0721.12 (HPLC [min or %B]) MS2 score: 53.4
21127740LSITGTYDLK555.8 (observed)29.87E+0525.42 (HPLC [min or %B]) MS2 score: 53.26
21127740LSITGTYDLK555.81 (observed)26.08E+0621.24 (HPLC [min or %B]) MS2 score: 52.45
21127740LSITGTYDLK555.81 (observed)21.83E+0621.41 (HPLC [min or %B]) MS2 score: 70.66
21127740LSITGTYDLK555.81 (observed)24.16E+0521.62 (HPLC [min or %B]) MS2 score: 39.55
21127740LSITGTYDLK555.81 (observed)22.42E+0521.57 (HPLC [min or %B]) MS2 score: 56.39
21127740LSITGTYDLK555.81 (observed)25.45E+0521.9 (HPLC [min or %B]) MS2 score: 52.64
21127740LSITGTYDLK555.81 (observed)21.08E+0621.01 (HPLC [min or %B]) MS2 score: 52.24
21127740LSITGTYDLK555.81 (observed)21.09E+0621.83 (HPLC [min or %B]) MS2 score: 37.34
21127740LSITGTYDLK555.81 (observed)22.90E+0625.3 (HPLC [min or %B]) MS2 score: 37.17
21127740LSITGTYDLK555.81 (observed)24.00E+0621.13 (HPLC [min or %B]) MS2 score: 52.95
21127740LSITGTYDLK555.81 (observed)21.58E+0720.95 (HPLC [min or %B]) MS2 score: 52.45
21127740LSITGTYDLK555.81 (observed)29.39E+0525.5 (HPLC [min or %B]) MS2 score: 56.07
21127740LSITGTYDLK555.81 (observed)29.23E+0525.34 (HPLC [min or %B]) MS2 score: 52.22
21127740LSITGTYDLK555.81 (observed)21.68E+0721.93 (HPLC [min or %B]) MS2 score: 53.38
21127740LSITGTYDLK555.81 (observed)23.71E+0721.54 (HPLC [min or %B]) MS2 score: 55.91
21127740LSITGTYDLK555.81 (observed)21.86E+0620.95 (HPLC [min or %B]) MS2 score: 37.21
21127740LSITGTYDLK555.81 (observed)21.16E+0621.33 (HPLC [min or %B]) MS2 score: 42.79
21127740LSITGTYDLK555.81 (observed)27.80E+0521.65 (HPLC [min or %B]) MS2 score: 36.94
21127740LSITGTYDLK555.81 (observed)28.25E+0622.15 (HPLC [min or %B]) MS2 score: 56.1
21127740LSITGTYDLK555.81 (observed)22.15E+0621.24 (HPLC [min or %B]) MS2 score: 52.93
21127740LSITGTYDLK555.81 (observed)23.12E+0620.83 (HPLC [min or %B]) MS2 score: 41.39
21127740LSITGTYDLK555.81 (observed)24.51E+0521.3 (HPLC [min or %B]) MS2 score: 52.49
21127740LSITGTYDLK555.81 (observed)21.90E+0521.92 (HPLC [min or %B]) MS2 score: 40.24
21127740LSITGTYDLK555.81 (observed)24.47E+0521.68 (HPLC [min or %B]) MS2 score: 51.67
21127740LSITGTYDLK555.81 (observed)28.38E+0521.86 (HPLC [min or %B]) MS2 score: 55.91
21127740LSITGTYDLK555.81 (observed)28.06E+0622 (HPLC [min or %B]) MS2 score: 55.92
21127740LSITGTYDLK555.8 (observed)21.00E+0630.6 (HPLC [min or %B]) MS2 score: 51.12
21127740LSITGTYDLK555.81 (observed)26.33E+0529.8 (HPLC [min or %B]) MS2 score: 40.52
21127740LSITGTYDLK555.8 (observed)24.52E+0622.12 (HPLC [min or %B]) MS2 score: 41.95
21127740LSITGTYDLK555.81 (observed)25.96E+0529.53 (HPLC [min or %B]) MS2 score: 53
21127740LSITGTYDLK555.81 (observed)21.37E+0529.83 (HPLC [min or %B]) MS2 score: 48.51
21127740LSITGTYDLK555.81 (observed)22.56E+0622.55 (HPLC [min or %B]) MS2 score: 51.63
21127740LSITGTYDLK555.81 (observed)22.86E+0622.85 (HPLC [min or %B]) MS2 score: 40.98
21127740LSITGTYDLK555.81 (observed)26.38E+0623.45 (HPLC [min or %B]) MS2 score: 58.8
21127740LSITGTYDLK555.8 (observed)23.30E+0630.29 (HPLC [min or %B]) MS2 score: 53.76
21127740LSITGTYDLK555.8 (observed)26.81E+0629.59 (HPLC [min or %B]) MS2 score: 45.18
21127740LSITGTYDLK555.81 (observed)23.18E+0629.77 (HPLC [min or %B]) MS2 score: 53.08
21127740LSITGTYDLK555.81 (observed)21.98E+0529.81 (HPLC [min or %B]) MS2 score: 44.67
21127740LSSWVLLMK538.81 (observed)23.70E+0531.76 (HPLC [min or %B]) MS2 score: 28.72
21127740LSSWVLLMK538.81 (observed)27.08E+0531.61 (HPLC [min or %B]) MS2 score: 34.5
21127740LSSWVLLMK538.81 (observed)21.10E+0631.75 (HPLC [min or %B]) MS2 score: 27.94
21127740LSSWVLLMK546.81 (observed)28.88E+0430.94 (HPLC [min or %B])Oxidation (M)MS2 score: 48.37
21127740LSSWVLLMK538.81 (observed)21.42E+0536.12 (HPLC [min or %B]) MS2 score: 27.49
21127740LSSWVLLMK546.81 (observed)24.49E+0526.32 (HPLC [min or %B])Oxidation (M)MS2 score: 21.34
21127740LSSWVLLMK538.81 (observed)29.02E+0531.77 (HPLC [min or %B]) MS2 score: 40.73
21127740LSSWVLLMK546.81 (observed)26.41E+0526.87 (HPLC [min or %B])Oxidation (M)MS2 score: 40.2
21127740LSSWVLLMK538.81 (observed)27.44E+0531.83 (HPLC [min or %B]) MS2 score: 46.65
21127740LSSWVLLMK546.81 (observed)26.36E+0626.65 (HPLC [min or %B])Oxidation (M)MS2 score: 49.09
21127740LSSWVLLMK538.81 (observed)22.34E+0631.52 (HPLC [min or %B]) MS2 score: 42.54
21127740LSSWVLLMK546.81 (observed)27.93E+0531.63 (HPLC [min or %B])Oxidation (M)MS2 score: 33.52
21127740LSSWVLLMK538.81 (observed)24.77E+0531.4 (HPLC [min or %B]) MS2 score: 42.64
21127740LSSWVLLMK538.81 (observed)22.13E+0531.57 (HPLC [min or %B]) MS2 score: 31.69
21127740LSSWVLLMK538.81 (observed)29.25E+0531.19 (HPLC [min or %B]) MS2 score: 26.89
21127740LSSWVLLMK538.81 (observed)21.00E+0631.43 (HPLC [min or %B]) MS2 score: 35.46
21127740LSSWVLLMK538.81 (observed)22.71E+0630.88 (HPLC [min or %B]) MS2 score: 39.27
21127740LSSWVLLMK546.81 (observed)21.81E+0626.27 (HPLC [min or %B])Oxidation (M)MS2 score: 35.02
21127740LSSWVLLMK538.81 (observed)24.05E+0631.19 (HPLC [min or %B]) MS2 score: 36.43
21127740LSSWVLLMK538.81 (observed)22.86E+0631.34 (HPLC [min or %B]) MS2 score: 41.49
21127740LSSWVLLMK546.81 (observed)21.14E+0626.51 (HPLC [min or %B])Oxidation (M)MS2 score: 39.35
21127740LSSWVLLMK546.81 (observed)21.10E+0626.24 (HPLC [min or %B])Oxidation (M)MS2 score: 40.34
21127740LSSWVLLMK538.81 (observed)26.44E+0631.18 (HPLC [min or %B]) MS2 score: 38.77
21127740LSSWVLLMK538.81 (observed)29.58E+0531.21 (HPLC [min or %B]) MS2 score: 36.95
21127740LSSWVLLMK538.81 (observed)25.97E+0531.65 (HPLC [min or %B]) MS2 score: 34.06
21127740LSSWVLLMK546.81 (observed)21.33E+0526.81 (HPLC [min or %B])Oxidation (M)MS2 score: 23.75
21127740LSSWVLLMK546.81 (observed)21.81E+0526.83 (HPLC [min or %B])Oxidation (M)MS2 score: 30.28
21127740LSSWVLLMK538.81 (observed)21.55E+0531.62 (HPLC [min or %B]) MS2 score: 36.95
21127740LSSWVLLMK546.81 (observed)23.41E+0526.58 (HPLC [min or %B])Oxidation (M)MS2 score: 27.14
21127740LSSWVLLMK538.81 (observed)28.10E+0530.81 (HPLC [min or %B]) MS2 score: 24.76
21127740LSSWVLLMK546.81 (observed)21.34E+0531.12 (HPLC [min or %B])Oxidation (M)MS2 score: 27.39
21127740LSSWVLLMK538.81 (observed)27.03E+0536.13 (HPLC [min or %B]) MS2 score: 53.13
21127740LSSWVLLMK546.81 (observed)21.37E+0631.2 (HPLC [min or %B])Oxidation (M)MS2 score: 32.91
21127740LSSWVLLMK538.81 (observed)21.08E+0631.4 (HPLC [min or %B]) MS2 score: 33.93
21127740SASLHLPK426.75 (observed)21.47E+053.66 (HPLC [min or %B]) MS2 score: 22.48
21127740SASLHLPK426.75 (observed)21.30E+057.4 (HPLC [min or %B]) MS2 score: 24.39
21127740SASLHLPK426.75 (observed)23.54E+058.52 (HPLC [min or %B]) MS2 score: 31.33
21127740SASLHLPK426.75 (observed)24.80E+059.55 (HPLC [min or %B]) MS2 score: 30.53
21127740SASLHLPK426.75 (observed)24.90E+0510.65 (HPLC [min or %B]) MS2 score: 32.66
21127740SASLHLPK426.75 (observed)27.47E+0511.87 (HPLC [min or %B]) MS2 score: 28.69
21127740SASLHLPK426.75 (observed)22.74E+053.05 (HPLC [min or %B]) MS2 score: 25.92
21127740SASLHLPK426.75 (observed)27.95E+044.15 (HPLC [min or %B]) MS2 score: 31.73
21127740SASLHLPK426.75 (observed)21.97E+055.16 (HPLC [min or %B]) MS2 score: 23.29
21127740SASLHLPK426.75 (observed)24.46E+057.19 (HPLC [min or %B]) MS2 score: 30.71
21127740SASLHLPK426.75 (observed)29.55E+058.28 (HPLC [min or %B]) MS2 score: 32.85
21127740SASLHLPK426.75 (observed)28.45E+059.44 (HPLC [min or %B]) MS2 score: 35.34
21127740SASLHLPK426.75 (observed)22.21E+0610.46 (HPLC [min or %B]) MS2 score: 28.86
21127740SASLHLPK426.75 (observed)21.27E+073.02 (HPLC [min or %B]) MS2 score: 40.48
21127740SASLHLPK426.75 (observed)21.57E+054.02 (HPLC [min or %B]) MS2 score: 30.77
21127740SASLHLPK426.75 (observed)21.44E+055.02 (HPLC [min or %B]) MS2 score: 22.47
21127740SASLHLPK426.75 (observed)23.46E+056.03 (HPLC [min or %B]) MS2 score: 31.97
21127740SASLHLPK426.75 (observed)23.93E+057.05 (HPLC [min or %B]) MS2 score: 31.59
21127740SASLHLPK426.75 (observed)26.03E+058.08 (HPLC [min or %B]) MS2 score: 36.8
21127740SASLHLPK426.75 (observed)21.08E+069.11 (HPLC [min or %B]) MS2 score: 29.76
21127740SASLHLPK426.75 (observed)21.26E+0610.13 (HPLC [min or %B]) MS2 score: 44.41
21127740SASLHLPK426.75 (observed)21.27E+0611.16 (HPLC [min or %B]) MS2 score: 34.29
21127740SASLHLPK426.75 (observed)24.14E+063.16 (HPLC [min or %B]) MS2 score: 35.84
21127740SASLHLPK426.75 (observed)21.10E+054.17 (HPLC [min or %B]) MS2 score: 24.47
21127740SASLHLPK426.75 (observed)21.03E+055.18 (HPLC [min or %B]) MS2 score: 27.28
21127740SASLHLPK426.75 (observed)28.96E+046.22 (HPLC [min or %B]) MS2 score: 20.35
21127740SASLHLPK426.75 (observed)21.46E+057.23 (HPLC [min or %B]) MS2 score: 43.48
21127740SASLHLPK426.75 (observed)24.98E+058.54 (HPLC [min or %B]) MS2 score: 33.84
21127740SASLHLPK426.75 (observed)25.94E+059.58 (HPLC [min or %B]) MS2 score: 35.59
21127740SASLHLPK426.75 (observed)25.14E+0510.59 (HPLC [min or %B]) MS2 score: 31.88
21127740SASLHLPK426.75 (observed)21.22E+0612.25 (HPLC [min or %B]) MS2 score: 37.97
21127740SASLHLPK426.75 (observed)25.58E+062.99 (HPLC [min or %B]) MS2 score: 48.19
21127740SASLHLPK426.75 (observed)21.04E+054.01 (HPLC [min or %B]) MS2 score: 26.79
21127740SASLHLPK426.75 (observed)29.21E+045.07 (HPLC [min or %B]) MS2 score: 22.68
21127740SASLHLPK426.75 (observed)21.77E+057.23 (HPLC [min or %B]) MS2 score: 27.81
21127740SASLHLPK426.75 (observed)22.61E+058.23 (HPLC [min or %B]) MS2 score: 29.17
21127740SASLHLPK426.75 (observed)22.65E+059.28 (HPLC [min or %B]) MS2 score: 26.83
21127740SASLHLPK426.75 (observed)21.56E+0510.32 (HPLC [min or %B]) MS2 score: 23.94
21127740SASLHLPK426.75 (observed)25.15E+0511.47 (HPLC [min or %B]) MS2 score: 25.37
21127740SASLHLPK426.75 (observed)27.03E+0410.64 (HPLC [min or %B]) MS2 score: 23.74
21127740SASLHLPK426.75 (observed)22.03E+0512.72 (HPLC [min or %B]) MS2 score: 25.44
21127740SASLHLPK426.75 (observed)26.91E+0411.87 (HPLC [min or %B]) MS2 score: 21.95
21127740SASLHLPK426.75 (observed)25.26E+0410.47 (HPLC [min or %B]) MS2 score: 24.72
21127740SASLHLPK426.75 (observed)23.55E+063.03 (HPLC [min or %B]) MS2 score: 35.53
21127740SASLHLPK426.75 (observed)21.23E+054.02 (HPLC [min or %B]) MS2 score: 21.59
21127740SASLHLPK426.75 (observed)26.46E+046.62 (HPLC [min or %B]) MS2 score: 37.62
21127740SASLHLPK426.75 (observed)21.38E+058.65 (HPLC [min or %B]) MS2 score: 25.28
21127740SASLHLPK426.75 (observed)21.50E+059.66 (HPLC [min or %B]) MS2 score: 30.77
21127740SASLHLPK426.75 (observed)22.56E+0511.69 (HPLC [min or %B]) MS2 score: 20.17
21127740SASLHLPK426.75 (observed)24.85E+0512.73 (HPLC [min or %B]) MS2 score: 37.54
21127740SASLHLPK426.75 (observed)27.61E+048.49 (HPLC [min or %B]) MS2 score: 21.55
21127740SASLHLPK426.75 (observed)21.43E+0512.36 (HPLC [min or %B]) MS2 score: 32.98
21127740SASLHLPK426.75 (observed)27.84E+0413.38 (HPLC [min or %B]) MS2 score: 24.58
21127740SASLHLPK426.75 (observed)26.29E+0411.68 (HPLC [min or %B]) MS2 score: 22.82
21127740SASLHLPK426.75 (observed)27.10E+0415.33 (HPLC [min or %B]) MS2 score: 26.1
21127740SASLHLPK426.75 (observed)21.20E+0516.35 (HPLC [min or %B]) MS2 score: 40.36
21127740SASLHLPK426.75 (observed)25.96E+063.13 (HPLC [min or %B]) MS2 score: 34.96
21127740SASLHLPK426.75 (observed)27.66E+048.11 (HPLC [min or %B]) MS2 score: 23.63
21127740SASLHLPK426.75 (observed)28.48E+049.13 (HPLC [min or %B]) MS2 score: 24.03
21127740SASLHLPK426.75 (observed)24.93E+0512.66 (HPLC [min or %B]) MS2 score: 26.98
21127740SASLHLPK426.75 (observed)22.36E+0616.01 (HPLC [min or %B]) MS2 score: 21.42
21127740SASLHLPK426.75 (observed)22.32E+0512.84 (HPLC [min or %B]) MS2 score: 30.24
21127740SASLHLPK426.75 (observed)28.34E+062.9 (HPLC [min or %B]) MS2 score: 41.72
21127740SASLHLPK426.75 (observed)22.57E+053.96 (HPLC [min or %B]) MS2 score: 44.34
21127740SASLHLPK426.75 (observed)22.30E+054.99 (HPLC [min or %B]) MS2 score: 41.43
21127740SASLHLPK426.75 (observed)23.91E+056 (HPLC [min or %B]) MS2 score: 34.21
21127740SASLHLPK426.75 (observed)24.58E+057.01 (HPLC [min or %B]) MS2 score: 40.35
21127740SASLHLPK426.75 (observed)28.96E+058.03 (HPLC [min or %B]) MS2 score: 38.28
21127740SASLHLPK426.75 (observed)29.60E+059.05 (HPLC [min or %B]) MS2 score: 49.61
21127740SASLHLPK426.75 (observed)21.03E+0610.17 (HPLC [min or %B]) MS2 score: 38.82
21127740SASLHLPK426.75 (observed)22.23E+0611.23 (HPLC [min or %B]) MS2 score: 35.97
21127740SASLHLPK426.75 (observed)22.04E+0612.26 (HPLC [min or %B]) MS2 score: 31.26
21127740SASLHLPK426.75 (observed)24.89E+053.06 (HPLC [min or %B]) MS2 score: 30.41
21127740SASLHLPK426.75 (observed)21.05E+0511.98 (HPLC [min or %B]) MS2 score: 23.58
21127740SASLHLPK426.75 (observed)22.42E+0513.04 (HPLC [min or %B]) MS2 score: 28.66
21127740SASLHLPK426.75 (observed)28.41E+0411.23 (HPLC [min or %B]) MS2 score: 23.04
21127740SASLHLPK426.75 (observed)25.79E+0513.83 (HPLC [min or %B]) MS2 score: 36.35
21127740SASLHLPK426.75 (observed)25.66E+0514.88 (HPLC [min or %B]) MS2 score: 30.77
21127740SASLHLPK426.75 (observed)22.66E+063.56 (HPLC [min or %B]) MS2 score: 30.2
21127740SASLHLPK426.75 (observed)21.22E+055.59 (HPLC [min or %B]) MS2 score: 22.45
21127740SASLHLPK426.75 (observed)24.03E+056.65 (HPLC [min or %B]) MS2 score: 25.65
21127740SASLHLPK426.75 (observed)23.66E+057.71 (HPLC [min or %B]) MS2 score: 30.06
21127740SASLHLPK426.75 (observed)25.03E+058.73 (HPLC [min or %B]) MS2 score: 28.45
21127740SASLHLPK426.75 (observed)24.41E+059.78 (HPLC [min or %B]) MS2 score: 28.87
21127740SASLHLPK426.75 (observed)28.78E+0510.8 (HPLC [min or %B]) MS2 score: 28.37
21127740SASLHLPK426.75 (observed)26.41E+0511.82 (HPLC [min or %B]) MS2 score: 22.8
21127740SASLHLPK426.75 (observed)21.98E+0612.84 (HPLC [min or %B]) MS2 score: 39.38
21127740SASLHLPK426.75 (observed)22.61E+0512.32 (HPLC [min or %B]) MS2 score: 22.49
21127740SASLHLPK426.75 (observed)24.37E+073.18 (HPLC [min or %B]) MS2 score: 32.21
21127740SASLHLPK426.75 (observed)21.40E+054.21 (HPLC [min or %B]) MS2 score: 23.82
21127740SASLHLPK426.75 (observed)29.62E+045.24 (HPLC [min or %B]) MS2 score: 23.26
21127740SASLHLPK426.75 (observed)22.74E+056.26 (HPLC [min or %B]) MS2 score: 28.4
21127740SASLHLPK426.75 (observed)23.54E+057.28 (HPLC [min or %B]) MS2 score: 24.76
21127740SASLHLPK426.75 (observed)24.94E+058.35 (HPLC [min or %B]) MS2 score: 24.88
21127740SASLHLPK426.75 (observed)29.08E+0510.6 (HPLC [min or %B]) MS2 score: 26.19
21127740SASLHLPK426.75 (observed)22.60E+0611.65 (HPLC [min or %B]) MS2 score: 44.09
21127740SASLHLPK426.75 (observed)22.56E+0513.5 (HPLC [min or %B]) MS2 score: 29.69
21127740SASLHLPK426.75 (observed)23.76E+0514.77 (HPLC [min or %B]) MS2 score: 27.72
21127740SASLHLPK426.75 (observed)26.70E+0515.82 (HPLC [min or %B]) MS2 score: 29.54
21127740SVLGQLGITK508.31 (observed)23.99E+0627.65 (HPLC [min or %B]) MS2 score: 45.7
21127740SVLGQLGITK508.31 (observed)21.21E+0623.92 (HPLC [min or %B]) MS2 score: 34.12
21127740SVLGQLGITK508.31 (observed)22.98E+0623.23 (HPLC [min or %B]) MS2 score: 26.48
21127740SVLGQLGITK508.31 (observed)21.28E+0628.29 (HPLC [min or %B]) MS2 score: 66.28
21127740SVLGQLGITK508.31 (observed)21.15E+0623.69 (HPLC [min or %B]) MS2 score: 46.45
21127740SVLGQLGITK508.31 (observed)25.33E+0524.02 (HPLC [min or %B]) MS2 score: 42.76
21127740SVLGQLGITK508.31 (observed)21.40E+0523.93 (HPLC [min or %B]) MS2 score: 25.88
21127740SVLGQLGITK508.31 (observed)29.42E+0423.93 (HPLC [min or %B]) MS2 score: 35.59
21127740SVLGQLGITK508.31 (observed)27.10E+0623.99 (HPLC [min or %B]) MS2 score: 66.86
21127740SVLGQLGITK508.31 (observed)21.71E+0726.53 (HPLC [min or %B]) MS2 score: 27.84
21127740SVLGQLGITK508.31 (observed)21.68E+0628.97 (HPLC [min or %B]) MS2 score: 50.9
21127740SVLGQLGITK508.31 (observed)21.89E+0628.94 (HPLC [min or %B]) MS2 score: 60.73
21127740SVLGQLGITK508.31 (observed)24.95E+0529.05 (HPLC [min or %B]) MS2 score: 51.18
21127740SVLGQLGITK508.31 (observed)22.52E+0628.68 (HPLC [min or %B]) MS2 score: 60.42
21127740SVLGQLGITK508.31 (observed)21.04E+0628.78 (HPLC [min or %B]) MS2 score: 48.16
21127740SVLGQLGITK508.31 (observed)21.51E+0628.67 (HPLC [min or %B]) MS2 score: 54.16
21127740SVLGQLGITK508.31 (observed)22.16E+0628.91 (HPLC [min or %B]) MS2 score: 51.5
21127740SVLGQLGITK508.31 (observed)22.17E+0628.37 (HPLC [min or %B]) MS2 score: 56.33
21127740SVLGQLGITK508.31 (observed)27.81E+0528.29 (HPLC [min or %B]) MS2 score: 64.28
21127740SVLGQLGITK508.31 (observed)21.47E+0628.4 (HPLC [min or %B]) MS2 score: 44.04
21127740SVLGQLGITK508.31 (observed)23.79E+0628.54 (HPLC [min or %B]) MS2 score: 71.51
21127740SVLGQLGITK508.31 (observed)25.28E+0528.52 (HPLC [min or %B]) MS2 score: 58.38
21127740SVLGQLGITK508.31 (observed)28.88E+0528.44 (HPLC [min or %B]) MS2 score: 60.25
21127740SVLGQLGITK508.31 (observed)27.80E+0529.37 (HPLC [min or %B]) MS2 score: 41.6
21127740SVLGQLGITK508.31 (observed)21.47E+0628.28 (HPLC [min or %B]) MS2 score: 58.49
21127740SVLGQLGITK508.31 (observed)23.03E+0629.24 (HPLC [min or %B]) MS2 score: 56.01
21127740SVLGQLGITK508.31 (observed)21.28E+0523.99 (HPLC [min or %B]) MS2 score: 24.32
21127740SVLGQLGITK508.31 (observed)23.88E+0524.03 (HPLC [min or %B]) MS2 score: 34.28
21127740SVLGQLGITK508.31 (observed)24.67E+0523.84 (HPLC [min or %B]) MS2 score: 48.02
21127740SVLGQLGITK508.31 (observed)21.14E+0628.03 (HPLC [min or %B]) MS2 score: 58.58
21127740SVLGQLGITK508.31 (observed)28.39E+0623.63 (HPLC [min or %B]) MS2 score: 52.86
21127740SVLGQLGITK508.31 (observed)23.59E+0623.5 (HPLC [min or %B]) MS2 score: 53.19
21127740SVLGQLGITK508.31 (observed)21.09E+0628.28 (HPLC [min or %B]) MS2 score: 63.25
21127740SVLGQLGITK508.31 (observed)23.93E+0528.17 (HPLC [min or %B]) MS2 score: 59.97
21127740SVLGQLGITK508.31 (observed)28.41E+0524.33 (HPLC [min or %B]) MS2 score: 55.04
21127740SVLGQLGITK508.31 (observed)21.26E+0623.89 (HPLC [min or %B]) MS2 score: 42.71
21127740SVLGQLGITK508.31 (observed)25.66E+0524.07 (HPLC [min or %B]) MS2 score: 35.45
21127740SVLGQLGITK508.31 (observed)24.49E+0524.16 (HPLC [min or %B]) MS2 score: 51.81
21127740SVLGQLGITK508.31 (observed)23.40E+0524.04 (HPLC [min or %B]) MS2 score: 48.39
21127740SVLGQLGITK508.31 (observed)24.66E+0524.07 (HPLC [min or %B]) MS2 score: 35.76
21127740SVLGQLGITK508.31 (observed)27.05E+0528.56 (HPLC [min or %B]) MS2 score: 49.84
21127740SVLGQLGITK508.31 (observed)21.95E+0623.76 (HPLC [min or %B]) MS2 score: 45.48
21127740SVLGQLGITK508.31 (observed)29.12E+0623.98 (HPLC [min or %B]) MS2 score: 54.33
21127740SVLGQLGITK508.31 (observed)21.15E+0623.56 (HPLC [min or %B]) MS2 score: 52.95
21127740SVLGQLGITK508.31 (observed)24.25E+0623.84 (HPLC [min or %B]) MS2 score: 57.46
21127740SVLGQLGITK508.31 (observed)26.73E+0524.04 (HPLC [min or %B]) MS2 score: 37.91
21127740SVLGQLGITK508.31 (observed)22.60E+0623.93 (HPLC [min or %B]) MS2 score: 49.05
21127740SVLGQLGITK508.31 (observed)21.38E+0624.05 (HPLC [min or %B]) MS2 score: 29.14
21127740SVLGQLGITK508.31 (observed)24.52E+0523.8 (HPLC [min or %B]) MS2 score: 44.73
21127740SVLGQLGITK508.31 (observed)21.00E+0524.28 (HPLC [min or %B]) MS2 score: 25.88
21127740SVLGQLGITK508.31 (observed)23.23E+0523.87 (HPLC [min or %B]) MS2 score: 46.96
21127740SVLGQLGITK508.31 (observed)25.02E+0524.16 (HPLC [min or %B]) MS2 score: 40.66
21127740SVLGQLGITK508.31 (observed)23.09E+0524.21 (HPLC [min or %B]) MS2 score: 50.32
21127740SVLGQLGITK508.31 (observed)22.49E+0524.24 (HPLC [min or %B]) MS2 score: 55.08
21127740SVLGQLGITK508.31 (observed)24.53E+0523.94 (HPLC [min or %B]) MS2 score: 36.3
21127740SVLGQLGITK508.31 (observed)24.91E+0524.11 (HPLC [min or %B]) MS2 score: 35.52
21127740SVLGQLGITK508.31 (observed)28.70E+0524.03 (HPLC [min or %B]) MS2 score: 50.21
21127740SVLGQLGITK508.31 (observed)22.04E+0524.11 (HPLC [min or %B]) MS2 score: 58.2
21127740SVLGQLGITK508.31 (observed)26.56E+0524.26 (HPLC [min or %B]) MS2 score: 52.6
21127740SVLGQLGITK508.31 (observed)25.47E+0524.18 (HPLC [min or %B]) MS2 score: 50.49
21127740SVLGQLGITK508.31 (observed)21.06E+0623.9 (HPLC [min or %B]) MS2 score: 57.97
21127740SVLGQLGITK508.31 (observed)21.16E+0523.96 (HPLC [min or %B]) MS2 score: 45.22
21127740SVLGQLGITK508.31 (observed)23.31E+0523.94 (HPLC [min or %B]) MS2 score: 52.28
21127740SVLGQLGITK508.31 (observed)28.84E+0523.9 (HPLC [min or %B]) MS2 score: 39.09
21127740SVLGQLGITK508.31 (observed)21.98E+0632.69 (HPLC [min or %B]) MS2 score: 54.36
21127740SVLGQLGITK508.31 (observed)21.55E+0524.99 (HPLC [min or %B]) MS2 score: 23.17
21127740SVLGQLGITK508.31 (observed)26.46E+0524.99 (HPLC [min or %B]) MS2 score: 50.85
21127740SVLGQLGITK508.31 (observed)24.55E+0624.86 (HPLC [min or %B]) MS2 score: 76.98
21127740SVLGQLGITK508.31 (observed)23.53E+0532.87 (HPLC [min or %B]) MS2 score: 47.48
21127740SVLGQLGITK508.31 (observed)29.12E+0525.27 (HPLC [min or %B]) MS2 score: 46
21127740SVLGQLGITK508.31 (observed)24.90E+0533.2 (HPLC [min or %B]) MS2 score: 30.28
21127740SVLGQLGITK508.31 (observed)21.72E+0624.97 (HPLC [min or %B]) MS2 score: 54.97
21127740SVLGQLGITK508.31 (observed)23.56E+0524.74 (HPLC [min or %B]) MS2 score: 37.51
21127740SVLGQLGITK508.31 (observed)22.49E+0524.59 (HPLC [min or %B]) MS2 score: 33.4
21127740SVLGQLGITK508.31 (observed)22.06E+0625.78 (HPLC [min or %B]) MS2 score: 40.69
21127740SVLGQLGITK508.31 (observed)25.77E+0524.96 (HPLC [min or %B]) MS2 score: 35.33
21127740SVLGQLGITK508.31 (observed)23.99E+0633.37 (HPLC [min or %B]) MS2 score: 50.79
21127740SVLGQLGITK508.31 (observed)26.30E+0532.89 (HPLC [min or %B]) MS2 score: 40.63
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.01E+0724.94 (HPLC [min or %B])Deamidation (NQ)MS2 score: 101.11
21127740VFSNGADLSGVTEEAPLK917.96 (observed)26.40E+0624.62 (HPLC [min or %B])Deamidation (NQ)MS2 score: 116.24
21127740VFSNGADLSGVTEEAPLK917.96 (observed)22.44E+0624.48 (HPLC [min or %B])Deamidation (NQ)MS2 score: 95.14
21127740VFSNGADLSGVTEEAPLK917.96 (observed)23.35E+0525.04 (HPLC [min or %B])Deamidation (NQ)MS2 score: 68.02
21127740VFSNGADLSGVTEEAPLK917.96 (observed)22.40E+0624.69 (HPLC [min or %B])Deamidation (NQ)MS2 score: 95.48
21127740VFSNGADLSGVTEEAPLK917.96 (observed)26.12E+0625.01 (HPLC [min or %B])Deamidation (NQ)MS2 score: 108.01
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.28E+0624.97 (HPLC [min or %B])Deamidation (NQ)MS2 score: 103.16
21127740VFSNGADLSGVTEEAPLK917.96 (observed)27.97E+0525.23 (HPLC [min or %B])Deamidation (NQ)MS2 score: 91.03
21127740VFSNGADLSGVTEEAPLK917.96 (observed)27.22E+0525.11 (HPLC [min or %B])Deamidation (NQ)MS2 score: 88.69
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.03E+0625.23 (HPLC [min or %B])Deamidation (NQ)MS2 score: 94.19
21127740VFSNGADLSGVTEEAPLK917.47 (observed)25.82E+0523.91 (HPLC [min or %B]) MS2 score: 90.93
21127740VFSNGADLSGVTEEAPLK917.47 (observed)22.77E+0624.02 (HPLC [min or %B]) MS2 score: 95.22
21127740VFSNGADLSGVTEEAPLK917.96 (observed)24.75E+0528.25 (HPLC [min or %B])Deamidation (NQ)MS2 score: 96.85
21127740VFSNGADLSGVTEEAPLK917.96 (observed)23.80E+0525.09 (HPLC [min or %B])Deamidation (NQ)MS2 score: 72.73
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.22E+0624.73 (HPLC [min or %B])Deamidation (NQ)MS2 score: 111.48
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.98E+0525.02 (HPLC [min or %B])Deamidation (NQ)MS2 score: 60.03
21127740VFSNGADLSGVTEEAPLK917.96 (observed)26.21E+0524.94 (HPLC [min or %B])Deamidation (NQ)MS2 score: 95.04
21127740VFSNGADLSGVTEEAPLK917.96 (observed)26.16E+0624.59 (HPLC [min or %B])Deamidation (NQ)MS2 score: 87.86
21127740VFSNGADLSGVTEEAPLK917.47 (observed)21.10E+0723.53 (HPLC [min or %B]) MS2 score: 105.95
21127740VFSNGADLSGVTEEAPLK611.98 (observed)32.07E+0623.58 (HPLC [min or %B]) MS2 score: 30.44
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.09E+0724.55 (HPLC [min or %B])Deamidation (NQ)MS2 score: 107.11
21127740VFSNGADLSGVTEEAPLK917.46 (observed)29.15E+0527.23 (HPLC [min or %B]) MS2 score: 80.18
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.10E+0628.29 (HPLC [min or %B])Deamidation (NQ)MS2 score: 87.76
21127740DTEEEDFHVDQVTTVK631.62 (observed)31.77E+0621.32 (HPLC [min or %B])Deamidation (NQ)MS2 score: 34.21
21127740DTEEEDFHVDQVTTVK631.29 (observed)35.18E+0522.28 (HPLC [min or %B]) MS2 score: 28.8
21127740DTEEEDFHVDQVTTVK631.29 (observed)36.95E+0520.68 (HPLC [min or %B]) MS2 score: 25.74
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.82E+0520.93 (HPLC [min or %B]) MS2 score: 52.84
21127740DTEEEDFHVDQVTTVK631.29 (observed)32.61E+0621.69 (HPLC [min or %B]) MS2 score: 52.54
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.41E+0621.97 (HPLC [min or %B]) MS2 score: 81.96
21127740DTEEEDFHVDQVTTVK631.29 (observed)32.35E+0624.4 (HPLC [min or %B]) MS2 score: 44.35
21127740DTEEEDFHVDQVTTVK946.43 (observed)26.85E+0516.75 (HPLC [min or %B]) MS2 score: 49.43
21127740DTEEEDFHVDQVTTVK631.29 (observed)32.98E+0518.38 (HPLC [min or %B]) MS2 score: 29.85
21127740DTEEEDFHVDQVTTVK946.43 (observed)29.11E+0520.93 (HPLC [min or %B]) MS2 score: 43.92
21127740DTEEEDFHVDQVTTVK946.43 (observed)28.36E+0521.92 (HPLC [min or %B]) MS2 score: 52.63
21127740DTEEEDFHVDQVTTVK946.43 (observed)21.39E+0622.49 (HPLC [min or %B]) MS2 score: 77.48
21127740DTEEEDFHVDQVTTVK946.43 (observed)25.48E+0522.64 (HPLC [min or %B]) MS2 score: 75.39
21127740DTVFALVNYIFFK788.92 (observed)25.44E+0548.24 (HPLC [min or %B]) MS2 score: 60.14
21127740DTVFALVNYIFFK526.29 (observed)35.52E+0548.4 (HPLC [min or %B]) MS2 score: 41.47
21127740DTVFALVNYIFFK788.93 (observed)24.95E+0548.33 (HPLC [min or %B]) MS2 score: 51.57
21127740DTVFALVNYIFFK788.93 (observed)22.01E+0548.39 (HPLC [min or %B]) MS2 score: 29.73
21127740DTVFALVNYIFFK788.92 (observed)22.67E+0547.97 (HPLC [min or %B]) MS2 score: 66.64
21127740DTVFALVNYIFFK788.92 (observed)21.31E+0548.14 (HPLC [min or %B]) MS2 score: 46.07
21127740DTVFALVNYIFFK788.92 (observed)27.99E+0548.19 (HPLC [min or %B]) MS2 score: 56.75
21127740DTVFALVNYIFFK788.92 (observed)21.11E+0548.38 (HPLC [min or %B]) MS2 score: 60.26
21127740DTVFALVNYIFFK526.28 (observed)31.20E+0548.34 (HPLC [min or %B]) MS2 score: 34.58
21127740DTVFALVNYIFFK788.93 (observed)22.64E+0548.56 (HPLC [min or %B]) MS2 score: 50.3
21127740DTVFALVNYIFFK788.93 (observed)21.18E+0548.26 (HPLC [min or %B]) MS2 score: 45.16
21127740DTVFALVNYIFFK788.92 (observed)22.05E+0548.28 (HPLC [min or %B]) MS2 score: 61.75
21127740ELDRDTVFALVNYIFFK1045.55 (observed)23.67E+0647.39 (HPLC [min or %B]) MS2 score: 56.43
21127740ELDRDTVFALVNYIFFK1045.55 (observed)24.28E+0547.42 (HPLC [min or %B]) MS2 score: 50.85
21127740ELDRDTVFALVNYIFFK697.37 (observed)31.49E+0647.78 (HPLC [min or %B]) MS2 score: 63.67
21127740ELDRDTVFALVNYIFFK697.37 (observed)32.81E+0547.5 (HPLC [min or %B]) MS2 score: 57.38
21127740ELDRDTVFALVNYIFFK697.37 (observed)32.80E+0547.46 (HPLC [min or %B]) MS2 score: 54.69
21127740ITPNLAEFAFSLYR821.44 (observed)21.15E+0639.42 (HPLC [min or %B]) MS2 score: 59.47
21127740ITPNLAEFAFSLYR821.43 (observed)27.88E+0443.69 (HPLC [min or %B]) MS2 score: 28.73
21127740ITPNLAEFAFSLYR547.96 (observed)39.37E+0540.09 (HPLC [min or %B]) MS2 score: 40.12
21127740ITPNLAEFAFSLYR821.44 (observed)22.12E+0539.61 (HPLC [min or %B]) MS2 score: 41.4
21127740ITPNLAEFAFSLYR547.96 (observed)31.54E+0639.51 (HPLC [min or %B]) MS2 score: 54.27
21127740ITPNLAEFAFSLYR821.44 (observed)23.50E+0543.34 (HPLC [min or %B]) MS2 score: 63.38
21127740ITPNLAEFAFSLYR547.96 (observed)31.10E+0543.47 (HPLC [min or %B]) MS2 score: 38.5
21127740ITPNLAEFAFSLYR821.44 (observed)23.49E+0543.21 (HPLC [min or %B]) MS2 score: 41.17
21127740ITPNLAEFAFSLYR821.43 (observed)22.76E+0543.24 (HPLC [min or %B]) MS2 score: 31.79
21127740ITPNLAEFAFSLYR547.96 (observed)32.49E+0539.66 (HPLC [min or %B]) MS2 score: 44.12
21127740ITPNLAEFAFSLYR547.96 (observed)32.74E+0539.97 (HPLC [min or %B]) MS2 score: 52.74
21127740ITPNLAEFAFSLYR821.44 (observed)23.45E+0543.05 (HPLC [min or %B]) MS2 score: 61.71
21127740ITPNLAEFAFSLYR821.44 (observed)21.77E+0642.88 (HPLC [min or %B]) MS2 score: 66.94
21127740ITPNLAEFAFSLYR547.96 (observed)31.86E+0643.01 (HPLC [min or %B]) MS2 score: 38.77
21127740ITPNLAEFAFSLYR821.44 (observed)22.57E+0743.09 (HPLC [min or %B]) MS2 score: 65.25
21127740ITPNLAEFAFSLYR821.44 (observed)24.73E+0643.18 (HPLC [min or %B]) MS2 score: 91.02
21127740ITPNLAEFAFSLYR547.96 (observed)35.69E+0539.54 (HPLC [min or %B]) MS2 score: 41.95
21127740ITPNLAEFAFSLYR821.44 (observed)21.66E+0639.51 (HPLC [min or %B]) MS2 score: 47.71
21127740ITPNLAEFAFSLYR821.44 (observed)21.46E+0639.5 (HPLC [min or %B]) MS2 score: 37.1
21127740ITPNLAEFAFSLYR821.44 (observed)26.05E+0539.8 (HPLC [min or %B]) MS2 score: 42.65
21127740ITPNLAEFAFSLYR821.44 (observed)29.09E+0543.42 (HPLC [min or %B]) MS2 score: 63.19
21127740KLSSWVLLMK610.86 (observed)24.42E+0524.12 (HPLC [min or %B])Oxidation (M)MS2 score: 29.97
21127740KLSSWVLLMK402.24 (observed)33.49E+0528.59 (HPLC [min or %B]) MS2 score: 29.33
21127740KLSSWVLLMK602.86 (observed)22.88E+0528.77 (HPLC [min or %B]) MS2 score: 14.86
21127740LGMFNIQHCK624.31 (observed)22.52E+0622.24 (HPLC [min or %B]) MS2 score: 26.98
21127740LGMFNIQHCK624.31 (observed)27.63E+0522.65 (HPLC [min or %B]) MS2 score: 31.48
21127740LGMFNIQHCK416.54 (observed)31.75E+0622.85 (HPLC [min or %B]) MS2 score: 25.24
21127740LGMFNIQHCK624.3 (observed)24.51E+0518.18 (HPLC [min or %B]) MS2 score: 28.62
21127740LGMFNIQHCK624.3 (observed)22.70E+0518.22 (HPLC [min or %B]) MS2 score: 35
21127740LQHLENELTHDIITK451.75 (observed)41.14E+0621.45 (HPLC [min or %B]) MS2 score: 40.56
21127740LQHLENELTHDIITK902.49 (observed)24.96E+0521.46 (HPLC [min or %B]) MS2 score: 59.09
21127740LQHLENELTHDIITK601.99 (observed)32.26E+0624.41 (HPLC [min or %B]) MS2 score: 39.62
21127740LQHLENELTHDIITK902.49 (observed)29.03E+0620.99 (HPLC [min or %B]) MS2 score: 66.88
21127740LQHLENELTHDIITK451.75 (observed)41.46E+0621.82 (HPLC [min or %B]) MS2 score: 37.35
21127740LQHLENELTHDIITK902.48 (observed)24.38E+0521.85 (HPLC [min or %B]) MS2 score: 56.81
21127740LQHLENELTHDIITK451.75 (observed)41.18E+0621.9 (HPLC [min or %B]) MS2 score: 43.01
21127740LQHLENELTHDIITK451.75 (observed)42.98E+0621.7 (HPLC [min or %B]) MS2 score: 31.17
21127740LQHLENELTHDIITK451.75 (observed)42.53E+0521.63 (HPLC [min or %B]) MS2 score: 37.2
21127740LQHLENELTHDIITK451.75 (observed)49.22E+0521.89 (HPLC [min or %B]) MS2 score: 35.08
21127740LQHLENELTHDIITK902.48 (observed)23.99E+0521.62 (HPLC [min or %B]) MS2 score: 62.76
21127740LQHLENELTHDIITK451.74 (observed)42.21E+0521.7 (HPLC [min or %B]) MS2 score: 34.36
21127740LQHLENELTHDIITK451.75 (observed)43.79E+0521.54 (HPLC [min or %B]) MS2 score: 32.65
21127740LQHLENELTHDIITK601.99 (observed)31.94E+0724.82 (HPLC [min or %B]) MS2 score: 47.28
21127740LQHLENELTHDIITK601.99 (observed)37.83E+0525.09 (HPLC [min or %B]) MS2 score: 33.42
21127740LQHLENELTHDIITK451.99 (observed)41.46E+0625.16 (HPLC [min or %B])Deamidation (NQ)MS2 score: 36.47
21127740LQHLENELTHDIITK602.32 (observed)34.40E+0623.2 (HPLC [min or %B])Deamidation (NQ)MS2 score: 56.55
21127740LQHLENELTHDIITK451.99 (observed)44.69E+0623.27 (HPLC [min or %B])Deamidation (NQ)MS2 score: 30.89
21127740LQHLENELTHDIITK601.99 (observed)31.62E+0724.66 (HPLC [min or %B]) MS2 score: 60.09
21127740LQHLENELTHDIITK902.49 (observed)22.84E+0624.67 (HPLC [min or %B]) MS2 score: 64.67
21127740LQHLENELTHDIITK451.75 (observed)49.64E+0624.7 (HPLC [min or %B]) MS2 score: 42.31
21127740LQHLENELTHDIITK451.75 (observed)46.39E+0625.08 (HPLC [min or %B]) MS2 score: 42.01
21127740LQHLENELTHDIITK601.99 (observed)36.37E+0524.73 (HPLC [min or %B]) MS2 score: 54.22
21127740LQHLENELTHDIITK602.32 (observed)31.10E+0725.03 (HPLC [min or %B])Deamidation (NQ)MS2 score: 53.24
21127740LQHLENELTHDIITK902.48 (observed)23.38E+0625.1 (HPLC [min or %B]) MS2 score: 72.43
21127740LQHLENELTHDIITK451.74 (observed)44.01E+0625.15 (HPLC [min or %B]) MS2 score: 37.68
21127740LQHLENELTHDIITK601.99 (observed)36.48E+0624.65 (HPLC [min or %B]) MS2 score: 49.29
21127740LQHLENELTHDIITK451.75 (observed)49.00E+0624.71 (HPLC [min or %B]) MS2 score: 37.34
21127740LQHLENELTHDIITK451.75 (observed)42.36E+0625.68 (HPLC [min or %B]) MS2 score: 42.69
21127740LQHLENELTHDIITK902.48 (observed)21.75E+0625.75 (HPLC [min or %B]) MS2 score: 58.7
21127740LQHLENELTHDIITK902.48 (observed)21.06E+0622.32 (HPLC [min or %B]) MS2 score: 80.54
21127740LQHLENELTHDIITK451.75 (observed)41.54E+0722.34 (HPLC [min or %B]) MS2 score: 51.19
21127740LQHLENELTHDIITK601.99 (observed)32.25E+0528.14 (HPLC [min or %B]) MS2 score: 33.12
21127740LQHLENELTHDIITK601.99 (observed)32.14E+0622.69 (HPLC [min or %B]) MS2 score: 46.03
21127740LQHLENELTHDIITK902.48 (observed)21.50E+0624.89 (HPLC [min or %B]) MS2 score: 59.22
21127740LQHLENELTHDIITK451.75 (observed)49.39E+0524.86 (HPLC [min or %B]) MS2 score: 28.24
21127740LQHLENELTHDIITK601.99 (observed)31.14E+0725.26 (HPLC [min or %B]) MS2 score: 48.59
21127740LQHLENELTHDIITK601.99 (observed)31.74E+0624.62 (HPLC [min or %B]) MS2 score: 35.24
21127740LQHLENELTHDIITK601.99 (observed)33.75E+0624.88 (HPLC [min or %B]) MS2 score: 35.17
21127740LQHLENELTHDIITK451.99 (observed)41.66E+0724.05 (HPLC [min or %B])Deamidation (NQ)MS2 score: 36.84
21127740LQHLENELTHDIITK451.74 (observed)43.24E+0629 (HPLC [min or %B]) MS2 score: 31.12
21127740LQHLENELTHDIITK602.32 (observed)31.82E+0728.86 (HPLC [min or %B])Deamidation (NQ)MS2 score: 35.34
21127740LQHLENELTHDIITK601.99 (observed)31.48E+0728.28 (HPLC [min or %B]) MS2 score: 45.63
21127740LQHLENELTHDIITK451.75 (observed)41.64E+0624.6 (HPLC [min or %B]) MS2 score: 39.05
21127740LQHLENELTHDIITK451.75 (observed)44.12E+0525.03 (HPLC [min or %B]) MS2 score: 41.86
21127740LQHLENELTHDIITK601.99 (observed)31.52E+0624.69 (HPLC [min or %B]) MS2 score: 40.81
21127740LQHLENELTHDIITK451.75 (observed)47.20E+0524.7 (HPLC [min or %B]) MS2 score: 32.43
21127740LQHLENELTHDIITK451.75 (observed)41.31E+0624.7 (HPLC [min or %B]) MS2 score: 30.55
21127740LQHLENELTHDIITK601.99 (observed)32.24E+0624.63 (HPLC [min or %B]) MS2 score: 38
21127740LQHLENELTHDIITK451.75 (observed)42.23E+0624.69 (HPLC [min or %B]) MS2 score: 32.03
21127740LQHLENELTHDIITK601.99 (observed)37.35E+0525.2 (HPLC [min or %B]) MS2 score: 50.58
21127740LQHLENELTHDIITK451.75 (observed)48.31E+0524.62 (HPLC [min or %B]) MS2 score: 29.05
21127740LQHLENELTHDIITK902.49 (observed)21.60E+0521.56 (HPLC [min or %B]) MS2 score: 33.67
21127740LQHLENELTHDIITK601.99 (observed)31.73E+0521.65 (HPLC [min or %B]) MS2 score: 30.01
21127740LQHLENELTHDIITK601.99 (observed)31.13E+0621.58 (HPLC [min or %B]) MS2 score: 44.39
21127740LQHLENELTHDIITK601.99 (observed)34.07E+0620.3 (HPLC [min or %B]) MS2 score: 53.46
21127740LSITGTYDLK555.81 (observed)21.92E+0625.61 (HPLC [min or %B]) MS2 score: 54.71
21127740LSITGTYDLK555.81 (observed)22.40E+0626.27 (HPLC [min or %B]) MS2 score: 52.69
21127740LSITGTYDLK555.81 (observed)27.08E+0526.18 (HPLC [min or %B]) MS2 score: 35.36
21127740LSITGTYDLK555.81 (observed)28.33E+0526.01 (HPLC [min or %B]) MS2 score: 48.09
21127740LSITGTYDLK555.81 (observed)22.39E+0625.67 (HPLC [min or %B]) MS2 score: 51.74
21127740LSITGTYDLK555.81 (observed)29.57E+0525.59 (HPLC [min or %B]) MS2 score: 48.13
21127740LSITGTYDLK555.81 (observed)28.93E+0626.13 (HPLC [min or %B]) MS2 score: 55.87
21127740LSITGTYDLK555.81 (observed)27.98E+0526.67 (HPLC [min or %B]) MS2 score: 32.62
21127740LSITGTYDLK555.81 (observed)21.27E+0625.74 (HPLC [min or %B]) MS2 score: 52.41
21127740LSITGTYDLK555.81 (observed)21.74E+0625.48 (HPLC [min or %B]) MS2 score: 53.03
21127740LSITGTYDLK555.81 (observed)21.32E+0625.69 (HPLC [min or %B]) MS2 score: 44.9
21127740LSITGTYDLK555.81 (observed)21.87E+0626.27 (HPLC [min or %B]) MS2 score: 49.09
21127740LSITGTYDLK555.81 (observed)23.11E+0625.81 (HPLC [min or %B]) MS2 score: 43.3
21127740LSITGTYDLK555.8 (observed)24.92E+0626.02 (HPLC [min or %B]) MS2 score: 37.99
21127740LSITGTYDLK555.81 (observed)29.96E+0625.72 (HPLC [min or %B]) MS2 score: 55.84
21127740LSITGTYDLK555.81 (observed)21.91E+0626.85 (HPLC [min or %B]) MS2 score: 54.08
21127740LSITGTYDLK555.81 (observed)23.04E+0626.29 (HPLC [min or %B]) MS2 score: 43.03
21127740LSITGTYDLK555.81 (observed)21.78E+0626.32 (HPLC [min or %B]) MS2 score: 31.13
21127740LSITGTYDLK555.8 (observed)25.72E+0621.11 (HPLC [min or %B]) MS2 score: 32.24
21127740LSITGTYDLK555.81 (observed)22.87E+0529.78 (HPLC [min or %B]) MS2 score: 52.2
21127740LSITGTYDLK555.81 (observed)22.92E+0529.5 (HPLC [min or %B]) MS2 score: 52.02
21127740LSITGTYDLK555.8 (observed)25.97E+0629.55 (HPLC [min or %B]) MS2 score: 42
21127740LSITGTYDLK555.81 (observed)26.14E+0529.7 (HPLC [min or %B]) MS2 score: 50.35
21127740LSITGTYDLK555.8 (observed)21.01E+0630.61 (HPLC [min or %B]) MS2 score: 53.84
21127740LSITGTYDLK555.81 (observed)24.94E+0530.08 (HPLC [min or %B]) MS2 score: 35.4
21127740LSITGTYDLK555.81 (observed)23.07E+0529.8 (HPLC [min or %B]) MS2 score: 52.64
21127740LSITGTYDLK555.81 (observed)22.46E+0521.69 (HPLC [min or %B]) MS2 score: 50.52
21127740LSITGTYDLK555.81 (observed)26.33E+0621.74 (HPLC [min or %B]) MS2 score: 56.05
21127740LSITGTYDLK555.81 (observed)28.06E+0521.74 (HPLC [min or %B]) MS2 score: 56.07
21127740LSITGTYDLK555.81 (observed)28.48E+0522.06 (HPLC [min or %B]) MS2 score: 53.01
21127740LSITGTYDLK555.81 (observed)29.44E+0421.44 (HPLC [min or %B]) MS2 score: 38.91
21127740LSITGTYDLK555.81 (observed)21.99E+0521.36 (HPLC [min or %B]) MS2 score: 36.75
21127740LSITGTYDLK555.81 (observed)21.11E+0621.31 (HPLC [min or %B]) MS2 score: 57.72
21127740LSITGTYDLK555.81 (observed)26.76E+0625.4 (HPLC [min or %B]) MS2 score: 46.33
21127740LSITGTYDLK555.81 (observed)22.70E+0525.55 (HPLC [min or %B]) MS2 score: 52.73
21127740LSITGTYDLK555.81 (observed)25.57E+0525.88 (HPLC [min or %B]) MS2 score: 48.3
21127740LSITGTYDLK555.81 (observed)21.83E+0625.37 (HPLC [min or %B]) MS2 score: 39.24
21127740LSITGTYDLK555.8 (observed)25.47E+0525.64 (HPLC [min or %B]) MS2 score: 45.3
21127740LSITGTYDLK555.8 (observed)21.04E+0625.39 (HPLC [min or %B]) MS2 score: 40.58
21127740LSITGTYDLK555.81 (observed)27.01E+0625.41 (HPLC [min or %B]) MS2 score: 52.08
21127740LSITGTYDLK555.81 (observed)29.55E+0525.24 (HPLC [min or %B]) MS2 score: 43.77
21127740LSITGTYDLK555.81 (observed)22.07E+0525.39 (HPLC [min or %B]) MS2 score: 30.26
21127740LSITGTYDLK555.81 (observed)22.45E+0523.97 (HPLC [min or %B]) MS2 score: 40.26
21127740LSITGTYDLK555.81 (observed)24.65E+0525.24 (HPLC [min or %B]) MS2 score: 42.5
21127740LSITGTYDLK555.81 (observed)25.60E+0624.79 (HPLC [min or %B]) MS2 score: 41.77
21127740LSITGTYDLK555.81 (observed)27.97E+0525.57 (HPLC [min or %B]) MS2 score: 51.38
21127740LSITGTYDLK555.81 (observed)21.37E+0623.52 (HPLC [min or %B]) MS2 score: 30.4
21127740LSITGTYDLK555.81 (observed)23.72E+0623.82 (HPLC [min or %B]) MS2 score: 51.86
21127740LSITGTYDLK555.8 (observed)21.76E+0625.32 (HPLC [min or %B]) MS2 score: 37.46
21127740LSITGTYDLK555.8 (observed)25.27E+0625.01 (HPLC [min or %B]) MS2 score: 51.69
21127740LSITGTYDLK555.81 (observed)21.06E+0525.72 (HPLC [min or %B]) MS2 score: 39.42
21127740LSSWVLLMK538.81 (observed)27.34E+0531.58 (HPLC [min or %B]) MS2 score: 36.27
21127740LSSWVLLMK538.81 (observed)22.42E+0631.14 (HPLC [min or %B]) MS2 score: 33.81
21127740LSSWVLLMK538.81 (observed)24.00E+0630.96 (HPLC [min or %B]) MS2 score: 39.45
21127740LSSWVLLMK538.81 (observed)21.00E+0536 (HPLC [min or %B]) MS2 score: 32.8
21127740LSSWVLLMK538.81 (observed)21.47E+0535.89 (HPLC [min or %B]) MS2 score: 48.9
21127740LSSWVLLMK538.81 (observed)21.09E+0631.77 (HPLC [min or %B]) MS2 score: 37.5
21127740LSSWVLLMK538.81 (observed)29.02E+0541.13 (HPLC [min or %B]) MS2 score: 35.49
21127740LSSWVLLMK538.81 (observed)21.33E+0632.32 (HPLC [min or %B]) MS2 score: 40.23
21127740LSSWVLLMK546.81 (observed)22.51E+0635.07 (HPLC [min or %B])Oxidation (M)MS2 score: 41.51
21127740LSSWVLLMK538.81 (observed)25.66E+0530.71 (HPLC [min or %B]) MS2 score: 38.35
21127740LSSWVLLMK546.81 (observed)23.26E+0631.06 (HPLC [min or %B])Oxidation (M)MS2 score: 36.87
21127740LSSWVLLMK546.81 (observed)23.39E+0631.02 (HPLC [min or %B])Oxidation (M)MS2 score: 48.03
21127740LSSWVLLMK538.81 (observed)29.90E+0536.05 (HPLC [min or %B]) MS2 score: 39.97
21127740LSSWVLLMK546.81 (observed)26.76E+0530.42 (HPLC [min or %B])Oxidation (M)MS2 score: 24.7
21127740LSSWVLLMK538.81 (observed)24.77E+0535.84 (HPLC [min or %B]) MS2 score: 41.79
21127740LSSWVLLMK538.81 (observed)27.29E+0532.37 (HPLC [min or %B]) MS2 score: 34.09
21127740LSSWVLLMK546.81 (observed)21.39E+0628.33 (HPLC [min or %B])Oxidation (M)MS2 score: 29.07
21127740LSSWVLLMK538.81 (observed)26.21E+0533.56 (HPLC [min or %B]) MS2 score: 39.05
21127740LSSWVLLMK546.81 (observed)21.09E+0630.67 (HPLC [min or %B])Oxidation (M)MS2 score: 35.06
21127740LSSWVLLMK538.81 (observed)25.60E+0535.72 (HPLC [min or %B]) MS2 score: 35.92
21127740LSSWVLLMK538.81 (observed)21.05E+0635.27 (HPLC [min or %B]) MS2 score: 18.95
21127740LSSWVLLMK538.81 (observed)22.59E+0541.63 (HPLC [min or %B]) MS2 score: 25.85
21127740LSSWVLLMK546.81 (observed)21.18E+0630.79 (HPLC [min or %B])Oxidation (M)MS2 score: 49.3
21127740LSSWVLLMK546.81 (observed)25.18E+0531.05 (HPLC [min or %B])Oxidation (M)MS2 score: 48.5
21127740LSSWVLLMK538.81 (observed)25.04E+0536.31 (HPLC [min or %B]) MS2 score: 43.55
21127740LSSWVLLMK546.81 (observed)23.90E+0527.01 (HPLC [min or %B])Oxidation (M)MS2 score: 25.68
21127740LYHSEAFTVNFGDTEEAK686.98 (observed)33.34E+0548.52 (HPLC [min or %B])Deamidation (NQ)MS2 score: 34.89
21127740LYHSEAFTVNFGDTEEAK686.98 (observed)37.84E+0626.88 (HPLC [min or %B])Deamidation (NQ)MS2 score: 45.47
21127740LYHSEAFTVNFGDTEEAK686.98 (observed)31.59E+0648.56 (HPLC [min or %B])Deamidation (NQ)MS2 score: 48.43
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)34.80E+0627.18 (HPLC [min or %B]) MS2 score: 26.88
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)31.88E+0623.65 (HPLC [min or %B]) MS2 score: 28.35
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)36.19E+0523.64 (HPLC [min or %B]) MS2 score: 42.36
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)38.45E+0524.08 (HPLC [min or %B]) MS2 score: 26.47
21127740SASLHLPK426.75 (observed)21.88E+0615.25 (HPLC [min or %B]) MS2 score: 31.88
21127740SASLHLPK426.75 (observed)27.02E+0513.88 (HPLC [min or %B]) MS2 score: 38.45
21127740SASLHLPK426.75 (observed)21.95E+0614.96 (HPLC [min or %B]) MS2 score: 34.47
21127740SASLHLPK426.75 (observed)21.40E+0615.97 (HPLC [min or %B]) MS2 score: 45.45
21127740SASLHLPK426.75 (observed)23.58E+0517.48 (HPLC [min or %B]) MS2 score: 36.22
21127740SASLHLPK426.75 (observed)21.17E+0617.33 (HPLC [min or %B]) MS2 score: 36.9
21127740SASLHLPK426.75 (observed)22.15E+0512.54 (HPLC [min or %B]) MS2 score: 32.15
21127740SASLHLPK426.75 (observed)21.89E+0615.48 (HPLC [min or %B]) MS2 score: 30.16
21127740SASLHLPK426.75 (observed)22.09E+0616.57 (HPLC [min or %B]) MS2 score: 27.42
21127740SASLHLPK426.75 (observed)21.48E+059.87 (HPLC [min or %B]) MS2 score: 28.17
21127740SASLHLPK426.75 (observed)21.38E+0511.97 (HPLC [min or %B]) MS2 score: 22.5
21127740SASLHLPK426.75 (observed)21.91E+0515.43 (HPLC [min or %B]) MS2 score: 21.41
21127740SASLHLPK426.75 (observed)22.75E+0514.97 (HPLC [min or %B]) MS2 score: 21.64
21127740SASLHLPK426.75 (observed)21.48E+0616.12 (HPLC [min or %B]) MS2 score: 38.05
21127740SASLHLPK426.75 (observed)26.98E+0516.21 (HPLC [min or %B]) MS2 score: 24.84
21127740SASLHLPK426.75 (observed)23.03E+0616.38 (HPLC [min or %B]) MS2 score: 35.03
21127740SASLHLPK426.75 (observed)21.26E+0616.26 (HPLC [min or %B]) MS2 score: 24.32
21127740SVLGQLGITK508.31 (observed)25.54E+0424.16 (HPLC [min or %B]) MS2 score: 22.92
21127740SVLGQLGITK508.31 (observed)29.19E+0524.32 (HPLC [min or %B]) MS2 score: 57.42
21127740SVLGQLGITK508.31 (observed)22.88E+0524.44 (HPLC [min or %B]) MS2 score: 33.97
21127740SVLGQLGITK508.31 (observed)23.72E+0524.21 (HPLC [min or %B]) MS2 score: 29.87
21127740SVLGQLGITK508.31 (observed)25.65E+0523.76 (HPLC [min or %B]) MS2 score: 41.36
21127740SVLGQLGITK508.31 (observed)22.27E+0723.57 (HPLC [min or %B]) MS2 score: 60.22
21127740SVLGQLGITK508.31 (observed)21.13E+0732.51 (HPLC [min or %B]) MS2 score: 55.39
21127740SVLGQLGITK508.31 (observed)26.23E+0632.53 (HPLC [min or %B]) MS2 score: 34.78
21127740SVLGQLGITK508.31 (observed)27.90E+0525.12 (HPLC [min or %B]) MS2 score: 39.25
21127740SVLGQLGITK508.31 (observed)22.91E+0623.97 (HPLC [min or %B]) MS2 score: 37.01
21127740SVLGQLGITK508.31 (observed)21.57E+0632.71 (HPLC [min or %B]) MS2 score: 32.33
21127740SVLGQLGITK508.31 (observed)22.28E+0524.97 (HPLC [min or %B]) MS2 score: 24.45
21127740SVLGQLGITK508.31 (observed)25.15E+0525 (HPLC [min or %B]) MS2 score: 40.76
21127740SVLGQLGITK508.31 (observed)21.33E+0523.8 (HPLC [min or %B]) MS2 score: 32.84
21127740SVLGQLGITK508.31 (observed)21.21E+0523.89 (HPLC [min or %B]) MS2 score: 27.23
21127740SVLGQLGITK508.31 (observed)22.25E+0524.12 (HPLC [min or %B]) MS2 score: 24.93
21127740SVLGQLGITK508.31 (observed)27.86E+0523.99 (HPLC [min or %B]) MS2 score: 43.77
21127740SVLGQLGITK508.31 (observed)21.40E+0633.68 (HPLC [min or %B]) MS2 score: 45.92
21127740SVLGQLGITK508.31 (observed)23.19E+0527.95 (HPLC [min or %B]) MS2 score: 34.29
21127740SVLGQLGITK508.31 (observed)26.36E+0528.11 (HPLC [min or %B]) MS2 score: 28.58
21127740SVLGQLGITK508.31 (observed)23.79E+0527.38 (HPLC [min or %B]) MS2 score: 27.39
21127740SVLGQLGITK508.31 (observed)22.03E+0728.56 (HPLC [min or %B]) MS2 score: 46.55
21127740SVLGQLGITK508.31 (observed)25.99E+0527.93 (HPLC [min or %B]) MS2 score: 52.76
21127740SVLGQLGITK508.31 (observed)22.77E+0628.9 (HPLC [min or %B]) MS2 score: 45.42
21127740SVLGQLGITK508.31 (observed)21.53E+0628.65 (HPLC [min or %B]) MS2 score: 48.02
21127740SVLGQLGITK508.31 (observed)21.09E+0628.66 (HPLC [min or %B]) MS2 score: 45.75
21127740SVLGQLGITK508.31 (observed)22.80E+0628.74 (HPLC [min or %B]) MS2 score: 26.65
21127740SVLGQLGITK508.31 (observed)24.28E+0628.56 (HPLC [min or %B]) MS2 score: 62.75
21127740SVLGQLGITK508.31 (observed)27.40E+0628.7 (HPLC [min or %B]) MS2 score: 58.59
21127740SVLGQLGITK508.31 (observed)21.40E+0628.51 (HPLC [min or %B]) MS2 score: 40.88
21127740SVLGQLGITK508.31 (observed)22.22E+0627.95 (HPLC [min or %B]) MS2 score: 48.07
21127740SVLGQLGITK508.31 (observed)29.10E+0627.76 (HPLC [min or %B]) MS2 score: 49.5
21127740SVLGQLGITK508.31 (observed)21.76E+0528.09 (HPLC [min or %B]) MS2 score: 32.68
21127740SVLGQLGITK508.31 (observed)21.38E+0528.26 (HPLC [min or %B]) MS2 score: 32.57
21127740SVLGQLGITK508.31 (observed)29.94E+0527.95 (HPLC [min or %B]) MS2 score: 41.39
21127740SVLGQLGITK508.31 (observed)24.40E+0627.93 (HPLC [min or %B]) MS2 score: 46.3
21127740SVLGQLGITK508.31 (observed)24.68E+0528.05 (HPLC [min or %B]) MS2 score: 41.53
21127740SVLGQLGITK508.31 (observed)25.05E+0527.87 (HPLC [min or %B]) MS2 score: 25.18
21127740SVLGQLGITK508.31 (observed)21.43E+0627.66 (HPLC [min or %B]) MS2 score: 46.17
21127740SVLGQLGITK508.31 (observed)23.70E+0527.99 (HPLC [min or %B]) MS2 score: 21.08
21127740SVLGQLGITK508.31 (observed)21.23E+0527.93 (HPLC [min or %B]) MS2 score: 40.88
21127740SVLGQLGITK508.31 (observed)21.08E+0628.06 (HPLC [min or %B]) MS2 score: 52.92
21127740SVLGQLGITK508.31 (observed)28.63E+0628.23 (HPLC [min or %B]) MS2 score: 46.58
21127740SVLGQLGITK508.31 (observed)24.98E+0527.95 (HPLC [min or %B]) MS2 score: 27.65
21127740SVLGQLGITK508.31 (observed)22.91E+0528.12 (HPLC [min or %B]) MS2 score: 40.28
21127740SVLGQLGITK508.31 (observed)21.46E+0627.98 (HPLC [min or %B]) MS2 score: 44.95
21127740SVLGQLGITK508.31 (observed)21.23E+0528.31 (HPLC [min or %B]) MS2 score: 40.42
21127740SVLGQLGITK508.31 (observed)21.32E+0528.32 (HPLC [min or %B]) MS2 score: 21.88
21127740SVLGQLGITK508.31 (observed)22.82E+0627.75 (HPLC [min or %B]) MS2 score: 23.14
21127740SVLGQLGITK508.31 (observed)21.02E+0627.65 (HPLC [min or %B]) MS2 score: 44.26
21127740TLNQPDSQLQLTTGNGLFLSEGLK1288.66 (observed)22.00E+0636.55 (HPLC [min or %B])2 Deamidation (NQ)MS2 score: 83.08
21127740TLNQPDSQLQLTTGNGLFLSEGLK859.12 (observed)31.15E+0735.84 (HPLC [min or %B])Deamidation (NQ)MS2 score: 83.42
21127740TLNQPDSQLQLTTGNGLFLSEGLK1288.17 (observed)24.86E+0635.91 (HPLC [min or %B])Deamidation (NQ)MS2 score: 95.71
21127740TLNQPDSQLQLTTGNGLFLSEGLK1288.17 (observed)28.62E+0536.08 (HPLC [min or %B])Deamidation (NQ)MS2 score: 80.09
21127740TLNQPDSQLQLTTGNGLFLSEGLK859.11 (observed)34.83E+0548.74 (HPLC [min or %B])Deamidation (NQ)MS2 score: 43.18
21127740VFSNGADLSGVTEEAPLK917.47 (observed)28.95E+0523.58 (HPLC [min or %B]) MS2 score: 83.81
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.52E+0624.62 (HPLC [min or %B])Deamidation (NQ)MS2 score: 83.64
21127740VFSNGADLSGVTEEAPLK917.47 (observed)29.50E+0524.12 (HPLC [min or %B]) MS2 score: 86.1
21127740VFSNGADLSGVTEEAPLK917.96 (observed)22.64E+0625.15 (HPLC [min or %B])Deamidation (NQ)MS2 score: 106.61
21127740VFSNGADLSGVTEEAPLK917.96 (observed)23.72E+0524.99 (HPLC [min or %B])Deamidation (NQ)MS2 score: 84.42
21127740VFSNGADLSGVTEEAPLK917.47 (observed)26.05E+0523.91 (HPLC [min or %B]) MS2 score: 109.59
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.27E+0624.92 (HPLC [min or %B])Deamidation (NQ)MS2 score: 84.13
21127740VFSNGADLSGVTEEAPLK917.47 (observed)29.99E+0523.97 (HPLC [min or %B]) MS2 score: 128.86
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.79E+0625.01 (HPLC [min or %B])Deamidation (NQ)MS2 score: 85.86
21127740VFSNGADLSGVTEEAPLK917.46 (observed)21.47E+0624.18 (HPLC [min or %B]) MS2 score: 128.89
21127740VFSNGADLSGVTEEAPLK917.46 (observed)21.12E+0624.34 (HPLC [min or %B]) MS2 score: 128.62
21127740VFSNGADLSGVTEEAPLK917.47 (observed)23.24E+0524.16 (HPLC [min or %B]) MS2 score: 77.25
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.38E+0625.79 (HPLC [min or %B])Deamidation (NQ)MS2 score: 115.72
21127740VFSNGADLSGVTEEAPLK917.46 (observed)21.50E+0631.59 (HPLC [min or %B]) MS2 score: 91.24
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.19E+0532.58 (HPLC [min or %B])Deamidation (NQ)MS2 score: 68.2
21127740VFSNGADLSGVTEEAPLK917.46 (observed)22.12E+0627.14 (HPLC [min or %B]) MS2 score: 79.32
21127740VFSNGADLSGVTEEAPLK917.95 (observed)25.25E+0628.13 (HPLC [min or %B])Deamidation (NQ)MS2 score: 87.34
21127740VFSNGADLSGVTEEAPLK917.46 (observed)21.70E+0627.38 (HPLC [min or %B]) MS2 score: 97.82
21127740VFSNGADLSGVTEEAPLK917.95 (observed)22.14E+0628.39 (HPLC [min or %B])Deamidation (NQ)MS2 score: 89.24
21127740VFSNGADLSGVTEEAPLK917.46 (observed)28.15E+0626.75 (HPLC [min or %B]) MS2 score: 92.32
21127740VFSNGADLSGVTEEAPLK917.47 (observed)21.45E+0627.67 (HPLC [min or %B]) MS2 score: 85.61
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.08E+0728.66 (HPLC [min or %B])Deamidation (NQ)MS2 score: 95.6
21127740VFSNGADLSGVTEEAPLK917.47 (observed)22.83E+0627.27 (HPLC [min or %B]) MS2 score: 85.32
21127740VFSNGADLSGVTEEAPLK917.47 (observed)23.78E+0527.39 (HPLC [min or %B]) MS2 score: 79.91
21127740VFSNGADLSGVTEEAPLK917.96 (observed)29.72E+0528.75 (HPLC [min or %B])Deamidation (NQ)MS2 score: 97.99
21127740VFSNGADLSGVTEEAPLK612.3 (observed)35.72E+0628.4 (HPLC [min or %B])Deamidation (NQ)MS2 score: 55.43
21127740VFSNGADLSGVTEEAPLK917.95 (observed)27.24E+0728.43 (HPLC [min or %B])Deamidation (NQ)MS2 score: 99.86
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.40E+0728.39 (HPLC [min or %B])Deamidation (NQ)MS2 score: 122.51
21127740VFSNGADLSGVTEEAPLK917.46 (observed)29.50E+0526.96 (HPLC [min or %B]) MS2 score: 96.55
21127740VFSNGADLSGVTEEAPLK917.47 (observed)23.19E+0527.21 (HPLC [min or %B]) MS2 score: 82.22
21127740VFSNGADLSGVTEEAPLK917.96 (observed)27.78E+0528.29 (HPLC [min or %B])Deamidation (NQ)MS2 score: 88.89
21127740VFSNGADLSGVTEEAPLK917.47 (observed)21.59E+0524.27 (HPLC [min or %B]) MS2 score: 46.8
21127740VFSNGADLSGVTEEAPLK611.98 (observed)35.29E+0524.28 (HPLC [min or %B]) MS2 score: 26.67
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.61E+0624.76 (HPLC [min or %B])Deamidation (NQ)MS2 score: 94.74
21127740VFSNGADLSGVTEEAPLK917.47 (observed)21.83E+0527.18 (HPLC [min or %B]) MS2 score: 56.54
21127740VVNPTQK393.72 (observed)21.93E+065.2 (HPLC [min or %B])Deamidation (NQ)MS2 score: 26.3
21127740VVNPTQK393.23 (observed)27.72E+065.41 (HPLC [min or %B]) MS2 score: 28.44
21127740VVNPTQK393.23 (observed)29.41E+054.47 (HPLC [min or %B]) MS2 score: 27.39
21127740AVLTIDEK444.76 (observed)21.91E+0610.74 (HPLC [min or %B]) MS2 score: 34.48
21127740DTEEEDFHVDQVTTVK631.29 (observed)39.24E+0522.02 (HPLC [min or %B]) MS2 score: 33.56
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.31E+0522.08 (HPLC [min or %B]) MS2 score: 64.87
21127740DTEEEDFHVDQVTTVK946.43 (observed)24.66E+0521.98 (HPLC [min or %B]) MS2 score: 70.4
21127740DTEEEDFHVDQVTTVK946.43 (observed)23.53E+0522.14 (HPLC [min or %B]) MS2 score: 84.66
21127740DTEEEDFHVDQVTTVK631.29 (observed)35.27E+0622.02 (HPLC [min or %B]) MS2 score: 40.43
21127740DTEEEDFHVDQVTTVK631.29 (observed)36.90E+0525.93 (HPLC [min or %B]) MS2 score: 31.9
21127740DTVFALVNYIFFK788.92 (observed)22.23E+0653.69 (HPLC [min or %B]) MS2 score: 75.31
21127740DTVFALVNYIFFK788.92 (observed)23.69E+0553.75 (HPLC [min or %B]) MS2 score: 30.06
21127740DTVFALVNYIFFK788.92 (observed)21.66E+0653.26 (HPLC [min or %B]) MS2 score: 59.22
21127740ELDRDTVFALVNYIFFK697.37 (observed)32.41E+0547.19 (HPLC [min or %B]) MS2 score: 46.72
21127740ELDRDTVFALVNYIFFK1045.55 (observed)22.01E+0547.47 (HPLC [min or %B]) MS2 score: 48.11
21127740ELDRDTVFALVNYIFFK1045.55 (observed)22.75E+0547.7 (HPLC [min or %B]) MS2 score: 37.4
21127740FIEDVK375.71 (observed)26.20E+0614.36 (HPLC [min or %B]) MS2 score: 36.22
21127740FLEDVK375.71 (observed)24.74E+0517.17 (HPLC [min or %B]) MS2 score: 27.45
21127740FLEDVK375.71 (observed)21.05E+0617.32 (HPLC [min or %B]) MS2 score: 25
21127740FLENEDRR360.18 (observed)32.58E+068.82 (HPLC [min or %B]) MS2 score: 25.13
21127740FNKPFVFLMIEQNTK619.33 (observed)32.67E+0633.9 (HPLC [min or %B]) MS2 score: 50.15
21127740FNKPFVFLMIEQNTK624.66 (observed)31.22E+0629.31 (HPLC [min or %B])Oxidation (M)MS2 score: 46.07
21127740FNKPFVFLMIEQNTK619.33 (observed)34.82E+0534.07 (HPLC [min or %B]) MS2 score: 40.28
21127740FNKPFVFLMIEQNTK624.66 (observed)37.29E+0532.91 (HPLC [min or %B])Oxidation (M)MS2 score: 37.16
21127740FNKPFVFLMIEQNTK624.66 (observed)35.27E+0632.62 (HPLC [min or %B])Oxidation (M)MS2 score: 46.16
21127740FNKPFVFLMIEQNTK624.66 (observed)31.95E+0637.24 (HPLC [min or %B])Oxidation (M)MS2 score: 51.58
21127740GKWERPFEVK638.35 (observed)28.11E+0618.51 (HPLC [min or %B]) MS2 score: 26.64
21127740GKWERPFEVK638.35 (observed)21.37E+0518.8 (HPLC [min or %B]) MS2 score: 27.45
21127740GKWERPFEVK638.35 (observed)26.36E+0518.05 (HPLC [min or %B]) MS2 score: 27.79
21127740ITPNLAEFAFSLYR821.44 (observed)29.59E+0543.41 (HPLC [min or %B]) MS2 score: 89.76
21127740ITPNLAEFAFSLYR821.43 (observed)21.00E+0648.37 (HPLC [min or %B]) MS2 score: 78.89
21127740ITPNLAEFAFSLYR821.43 (observed)26.08E+0548.6 (HPLC [min or %B]) MS2 score: 83.79
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 16   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 10   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 39   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 15   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 15   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 11   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 21   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 40   
UNPUBLISHED_1K.AVLTIDEK.G    MS2 score: 7   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 25   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 22   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 55   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 17   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 7   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 29   
UNPUBLISHED_1K.DTEEEDFHVDQVTTVK.V    MS2 score: 42   
UNPUBLISHED_1K.FLEDVKK.L    MS2 score: 3   
UNPUBLISHED_1K.FLEDVKK.L    MS2 score: 10   
UNPUBLISHED_1K.FLENEDRR.S    MS2 score: 1   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 6   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 13   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 29   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 4   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 47   
UNPUBLISHED_1K.FNKPFVFLMIEQNTK.S    MS2 score: 5   
UNPUBLISHED_1K.GKWERPFEVK.D    MS2 score: 6   
UNPUBLISHED_1K.GTEAAGAMFLEAIPMSIPPEVK.F    MS2 score: 3   
UNPUBLISHED_1K.GTEAAGAMFLEAIPMSIPPEVK.F    MS2 score: 15   
UNPUBLISHED_1K.GTEAAGAMFLEAIPMSIPPEVK.F    MS2 score: 18   
UNPUBLISHED_1K.GTQGK.I    MS2 score: 3   
UNPUBLISHED_1K.GTQGK.I    MS2 score: 0   
UNPUBLISHED_1K.GTQGK.I    MS2 score: 1   
UNPUBLISHED_1K.ITPNLAEFAFSLYR.Q    MS2 score: 32   
UNPUBLISHED_1K.ITPNLAEFAFSLYR.Q    MS2 score: 40   
UNPUBLISHED_1K.ITPNLAEFAFSLYR.Q    MS2 score: 40   
UNPUBLISHED_1K.ITPNLAEFAFSLYR.Q    MS2 score: 45   
UNPUBLISHED_1K.IVDLVK.E    MS2 score: 5   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 14   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 0   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 13   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 17   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 30   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 3   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 6   
UNPUBLISHED_1K.KLSSWVLLMK.Y    MS2 score: 7   
UNPUBLISHED_1K.KLYHSEAFTVNFGDTEEAK.K    MS2 score: 1   
21538913K.LQHLENELTHDIITK.F    MS2 score: 0 
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 9   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 4   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 3   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 5   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 3   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 42   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 37   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 17   
UNPUBLISHED_1K.LQHLENELTHDIITK.F    MS2 score: 28   
UNPUBLISHED_1K.LQHLENELTHDIITKFLENEDR.R    MS2 score: 19   
UNPUBLISHED_1K.LQHLENELTHDIITKFLENEDR.R    MS2 score: 13   
21538913K.LSITGTYDLK.S    MS2 score: 8 
21538913K.LSITGTYDLK.S    MS2 score: 8 
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 9   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 17   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 5   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 13   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 12   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 12   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 7   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 12   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 11   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 7   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 11   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 14   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 12   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 9   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 7   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 16   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 6   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 14   
UNPUBLISHED_1K.LSITGTYDLK.S    MS2 score: 14   
UNPUBLISHED_1K.LSSWVLLMK.Y    MS2 score: 9   
UNPUBLISHED_1K.LSSWVLLMK.Y    MS2 score: 13   
UNPUBLISHED_1K.LSSWVLLMK.Y    MS2 score: 10   
UNPUBLISHED_1K.LVDKFLEDVK.K    MS2 score: 7   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 2   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 46   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 41   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 49   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 19   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 8   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 41   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 44   
UNPUBLISHED_1K.LYHSEAFTVNFGDTEEAKK.Q    MS2 score: 15   
UNPUBLISHED_1K.QINDYVEKGTQGK.I    MS2 score: 4   
UNPUBLISHED_1K.QINDYVEKGTQGK.I    MS2 score: 5   
UNPUBLISHED_1K.QINDYVEKGTQGK.I    MS2 score: 1   
UNPUBLISHED_1K.SPLFMGKVVNPTQK.-    MS2 score: 2   
UNPUBLISHED_1K.SPLFMGKVVNPTQK.-    MS2 score: 1   
UNPUBLISHED_1K.SPLFMGKVVNPTQK.-    MS2 score: 5   
21538913K.SVLGQLGITK.V    MS2 score: 11 
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 9   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 16   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 26   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 18   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 15   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 37   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 14   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 21   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 23   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 37   
UNPUBLISHED_1K.SVLGQLGITK.V    MS2 score: 37   
21538913K.VFSNGADLSGVTEEAPLK.L    MS2 score: 26 
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 66   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 38   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 69   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 47   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 35   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 31   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 22   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 28   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 30   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 37   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 45   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 57   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 44   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 38   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 39   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 23   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 31   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 36   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 18   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 51   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 8   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 43   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 29   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 10   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 42   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 48   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 24   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 55   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 31   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 15   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 31   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 45   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 38   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLK.L    MS2 score: 36   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 12   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 38   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 37   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 9   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 0   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 10   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 1   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 36   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 58   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 45   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 20   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 40   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 30   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 36   
UNPUBLISHED_1K.VFSNGADLSGVTEEAPLKLSK.A    MS2 score: 36   
UNPUBLISHED_1K.VVNPTQK.-    MS2 score: 18   
UNPUBLISHED_1K.VVNPTQK.-    MS2 score: 20   
21127740KLSSWVLLMK602.86 (observed)21.41E+0628.4 (HPLC [min or %B]) MS2 score: 38.29
21127740KLSSWVLLMK402.24 (observed)37.64E+0528.86 (HPLC [min or %B]) MS2 score: 26.81
21127740KLSSWVLLMK602.86 (observed)21.49E+0627.9 (HPLC [min or %B]) MS2 score: 18.86
21127740LGMFNIQHCK624.3 (observed)24.36E+0522.56 (HPLC [min or %B]) MS2 score: 32.37
21127740LGMFNIQHCK624.3 (observed)25.52E+0518.66 (HPLC [min or %B]) MS2 score: 26.58
21127740LQHLENELTHDIITK601.99 (observed)31.91E+0622.22 (HPLC [min or %B]) MS2 score: 62.61
21127740LQHLENELTHDIITK451.75 (observed)42.48E+0624.66 (HPLC [min or %B]) MS2 score: 39.31
21127740LQHLENELTHDIITK902.48 (observed)28.35E+0524.74 (HPLC [min or %B]) MS2 score: 53.7
21127740LSSWVLLMK538.81 (observed)26.20E+0631.71 (HPLC [min or %B]) MS2 score: 30.28
21127740LSSWVLLMK546.81 (observed)21.36E+0630.61 (HPLC [min or %B])Oxidation (M)MS2 score: 36.51
21127740LSSWVLLMK546.81 (observed)21.35E+0630.42 (HPLC [min or %B])Oxidation (M)MS2 score: 34.86
21127740LSSWVLLMK546.81 (observed)26.94E+0631.24 (HPLC [min or %B])Oxidation (M)MS2 score: 48.41
21127740LVDKFLEDVK603.34 (observed)21.26E+0624.68 (HPLC [min or %B]) MS2 score: 28.19
21127740LVDKFLEDVK402.56 (observed)32.88E+0625.87 (HPLC [min or %B]) MS2 score: 25.95
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)32.48E+0523.48 (HPLC [min or %B]) MS2 score: 25.02
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)35.27E+0523.66 (HPLC [min or %B]) MS2 score: 27.76
21127740LYHSEAFTVNFGDTEEAK1029.48 (observed)22.71E+0523.68 (HPLC [min or %B]) MS2 score: 69.74
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)31.56E+0623.59 (HPLC [min or %B]) MS2 score: 50.98
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)35.24E+0526.84 (HPLC [min or %B]) MS2 score: 29.99
21127740LYHSEAFTVNFGDTEEAK686.65 (observed)39.50E+0530.89 (HPLC [min or %B]) MS2 score: 32.51
21127740LYHSEAFTVNFGDTEEAKK729.35 (observed)39.10E+0521.63 (HPLC [min or %B]) MS2 score: 31.35
21127740LYHSEAFTVNFGDTEEAKK547.51 (observed)42.16E+0724.15 (HPLC [min or %B])Deamidation (NQ)MS2 score: 29.3
21127740QINDYVEK504.75 (observed)29.61E+0510.93 (HPLC [min or %B]) MS2 score: 26.19
21127740QINDYVEK504.75 (observed)29.86E+0611.65 (HPLC [min or %B]) MS2 score: 35.05
UNPUBLISHED_1R.RSASLHLPK.L    MS2 score: 7   
21538913R.SASLHLPK.L    MS2 score: 37 
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 13   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 28   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 46   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 14   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 22   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 14   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 5   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 10   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 13   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 9   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 13   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 18   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 19   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 29   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 13   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 5   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 13   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 28   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 8   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 17   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 35   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 16   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 11   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 21   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 48   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 52   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 19   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 11   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 34   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 34   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 10   
UNPUBLISHED_1R.SASLHLPK.L    MS2 score: 17   
UNPUBLISHED_1R.SASLHLPKLSITGTYDLK.S    MS2 score: 1   
UNPUBLISHED_1R.SASLHLPKLSITGTYDLK.S    MS2 score: 10   
UNPUBLISHED_1R.SASLHLPKLSITGTYDLK.S    MS2 score: 1   
21127740SASLHLPK426.75 (observed)22.18E+0620.09 (HPLC [min or %B]) MS2 score: 27.54
21127740SASLHLPK426.75 (observed)22.33E+0611.99 (HPLC [min or %B]) MS2 score: 31.56
21127740SPLFMGK390.21 (observed)26.51E+0521.15 (HPLC [min or %B]) MS2 score: 25.34
21127740SPLFMGK390.21 (observed)21.13E+0621.82 (HPLC [min or %B]) MS2 score: 26.88
21127740SPLFMGK398.21 (observed)27.00E+0612.65 (HPLC [min or %B])Oxidation (M)MS2 score: 24.14
21127740TDTSHHDQDHPTFNK593.93 (observed)31.01E+065.9 (HPLC [min or %B]) MS2 score: 33.62
21127740VFSNGADLSGVTEEAPLK917.47 (observed)23.68E+0526.94 (HPLC [min or %B]) MS2 score: 87.52
21127740VFSNGADLSGVTEEAPLK917.96 (observed)21.58E+0624.88 (HPLC [min or %B])Deamidation (NQ)MS2 score: 120.52
21127740VFSNGADLSGVTEEAPLK917.47 (observed)21.34E+0626.97 (HPLC [min or %B]) MS2 score: 91.41
21127740VVNPTQK393.23 (observed)29.53E+048.72 (HPLC [min or %B]) MS2 score: 28.42
21127740VVNPTQK393.23 (observed)23.70E+064.59 (HPLC [min or %B]) MS2 score: 24.11
21127740VVNPTQK393.23 (observed)22.11E+068.49 (HPLC [min or %B]) MS2 score: 24.24
21127740YIFFK359.2 (observed)21.81E+0724.68 (HPLC [min or %B]) MS2 score: 25.05
23376485DTEEEDFHVDQVTTVK946.432 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.438 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.294 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.437 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.432 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.433 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.436 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.291 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.291 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.291 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.292 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.294 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.295 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.293 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.435 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.29 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.437 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.295 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK946.439 (observed)   :::::::::::::::::
23376485DTEEEDFHVDQVTTVK631.291 (observed)   :::::::::::::::::
23376485ELDRDTVFALVNYIFFK697.377 (observed)   ::::::::::::::::::
23376485ELDRDTVFALVNYIFFK1045.564 (observed)   ::::::::::::::::::
23376485ELDRDTVFALVNYIFFK697.375 (observed)   ::::::::::::::::::
23376485FNKPFVFLMIEQNTK619.334 (observed)   ::::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1146.076 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.387 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.386 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1138.076 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.385 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.386 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1130.081 (observed)   :::::::::::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1138.08 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.384 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK753.72 (observed)   :::::::::::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK759.052 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.384 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1138.073 (observed)   ::::::::Oxidation_M:::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1138.075 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1138.073 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1130.086 (observed)   :::::::::::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK1146.074 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK764.388 (observed)   ::::::::Oxidation_M:::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK759.055 (observed)   :::::::::::::::Oxidation_M::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK753.725 (observed)   :::::::::::::::::::::::
23376485GTEAAGAMFLEAIPMSIPPEVK759.052 (observed)   :::::::::::::::Oxidation_M::::::::
23376485ITPNLAEFAFSLYR821.437 (observed)   :::::::::::::::
23376485ITPNLAEFAFSLYR821.446 (observed)   :::::::::::::::
23376485ITPNLAEFAFSLYR547.963 (observed)   :::::::::::::::
23376485ITPNLAEFAFSLYR821.442 (observed)   :::::::::::::::
23376485KLSSWVLLMK610.859 (observed)   :::::::::Oxidation_M::
23376485KLSSWVLLMK602.858 (observed)   :::::::::::
23376485KLSSWVLLMK602.863 (observed)   :::::::::::
23376485KLSSWVLLMK602.862 (observed)   :::::::::::
23376485KLSSWVLLMK602.862 (observed)   :::::::::::
23376485KLSSWVLLMK610.859 (observed)   :::::::::Oxidation_M::
23376485KLSSWVLLMK602.861 (observed)   :::::::::::
23376485KLSSWVLLMK602.863 (observed)   :::::::::::
23376485KLSSWVLLMK602.863 (observed)   :::::::::::
23376485KLSSWVLLMK602.863 (observed)   :::::::::::
23376485LGMFNIQHCK421.871 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK632.301 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK632.306 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK632.301 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK421.874 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK632.301 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LGMFNIQHCK632.305 (observed)   :::Oxidation_M::::::Cys_CAM::
23376485LQHLENELTHDIITK601.993 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.485 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.992 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.992 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.992 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.486 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.49 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.488 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.49 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.996 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.993 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.993 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.489 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.993 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK451.747 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.488 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK902.494 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK451.748 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.992 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.995 (observed)   ::::::::::::::::
23376485LQHLENELTHDIITK601.994 (observed)   ::::::::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.806 (observed)   :::::::::::
23376485LSITGTYDLK555.809 (observed)   :::::::::::
23376485LSITGTYDLK555.809 (observed)   :::::::::::
23376485LSITGTYDLK555.808 (observed)   :::::::::::
23376485LSITGTYDLK555.808 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.808 (observed)   :::::::::::
23376485LSITGTYDLK555.806 (observed)   :::::::::::
23376485LSITGTYDLK555.806 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.808 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.808 (observed)   :::::::::::
23376485LSITGTYDLK555.809 (observed)   :::::::::::
23376485LSITGTYDLK555.809 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSITGTYDLK555.809 (observed)   :::::::::::
23376485LSITGTYDLK555.807 (observed)   :::::::::::
23376485LSSWVLLMK538.811 (observed)   ::::::::::
23376485LSSWVLLMK546.811 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK546.81 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK538.814 (observed)   ::::::::::
23376485LSSWVLLMK538.813 (observed)   ::::::::::
23376485LSSWVLLMK546.81 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK546.812 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK546.813 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK538.812 (observed)   ::::::::::
23376485LSSWVLLMK546.809 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK538.816 (observed)   ::::::::::
23376485LSSWVLLMK538.814 (observed)   ::::::::::
23376485LSSWVLLMK546.812 (observed)   ::::::::Oxidation_M::
23376485LSSWVLLMK538.813 (observed)   ::::::::::
23376485LYHSEAFTVNFGDTEEAK1029.478 (observed)   :::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAK686.656 (observed)   :::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.354 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.265 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.354 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.355 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.356 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.357 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.269 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.267 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.269 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.355 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.266 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK729.358 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.267 (observed)   ::::::::::::::::::::
23376485LYHSEAFTVNFGDTEEAKK547.268 (observed)   ::::::::::::::::::::
23376485RLGMFNIQHCK468.573 (observed)   ::::::::::Cys_CAM::
23376485SVLGQLGITK508.31 (observed)   :::::::::::
23376485SVLGQLGITK508.311 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.311 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.311 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.314 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.312 (observed)   :::::::::::
23376485SVLGQLGITK508.313 (observed)   :::::::::::
23376485VFSNGADLSGVTEEAPLK917.469 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.465 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.469 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.467 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.471 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.472 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.466 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.471 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.468 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.477 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.469 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.473 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.466 (observed)   :::::::::::::::::::
23376485VFSNGADLSGVTEEAPLK917.469 (observed)   :::::::::::::::::::

Compile date 12-23-2014© PADB initiative