PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A7979ACAA2Acetyl-CoA acyltransferase 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KAANEAGYFNEEM*APIEVKT 2    
18501002KAANEAGYFNEEMAPIEVKT 1    
18501002KAANEAGYFNEEMAPIEVKT 2    
18501002KAGLSLKDM*DLIDVNEAFAPQFLSVQKA 3    
18501002KAGLSLKDM*DLIDVNEAFAPQFLSVQKA 2    
18501002KAGLSLKDMDLIDVNEAFAPQFLSVQKA 3    
18501002KAGLSLKDMDLIDVNEAFAPQFLSVQKA 2    
18501002KALDLDPSKTNVSGGAIALGHPLGGSGSRI 3    
18501002KALDLDPSKTNVSGGAIALGHPLGGSGSRI 2    
18501002KDFSATDLTEFAARA 2    
18501002KDGTVTAGNASGVSDGAGAVIIASEDAVKK 3    
18501002KDGTVTAGNASGVSDGAGAVIIASEDAVKK 2    
18501002KDGTVTAGNASGVSDGAGAVIIASEDAVKKH 3    
18501002KDM*DLIDVNEAFAPQFLSVQKA 2    
18501002KDMDLIDVNEAFAPQFLSVQKA 2    
18501002KDMDLIDVNEAFAPQFLSVQKA 3    
18501002KGKQTMQVDEHARPQTTLEQLQKL 3    
18501002KKHNFTPLARV 2    
18501002KLEDTLWAGLTDQHVKL 2    
18501002KLEDTLWAGLTDQHVKL 3    
18501002KLEDTLWAGLTDQHVKLPM*GMTAENLAAKY 3    
18501002KLEDTLWAGLTDQHVKLPMGMTAENLAAKY 3    
18501002KLPM*GM*TAENLAAKY 2    
18501002KLPMGMTAENLAAKY 2    
18501002KQTM*QVDEHARPQTTLEQLQKL 3    
18501002KQTMQVDEHARPQTTLEQLQKL 3    
18501002KQTMQVDEHARPQTTLEQLQKLPSVFKK 3    
18501002KRTPFGAYGGLLKD 2    
18501002KRTPFGAYGGLLKD 3    
18501002KRTPFGAYGGLLKDFSATDLTEFAARA 3    
18501002KTNVSGGAIALGHPLGGSGSRI 2    
18501002KTNVSGGAIALGHPLGGSGSRI 3    
18501002KVPPETIDSVIVGNVMQSSSDAAYLARH 2    
18501002KVPPETIDSVIVGNVMQSSSDAAYLARH 3    
18501002RAALSAGKVPPETIDSVIVGNVM*QSSSDAAYLARH 3    
18501002RAALSAGKVPPETIDSVIVGNVMQSSSDAAYLARH 3    
18501002RAALSAGKVPPETIDSVIVGNVMQSSSDAAYLARH 2    
18501002RTPFGAYGGLLKD 2    
18501002RTPFGAYGGLLKDFSATDLTEFAARA 3    
18501002RVGVPTETGALTLNRL 2    
18501002RVVGYFVSGCDPTIMGIGPVPAINGALKKA 3    
18501002RWKAANEAGYFNEEM*APIEVKT 3    
18501002RWKAANEAGYFNEEMAPIEVKT 3    
18501002RWKAANEAGYFNEEMAPIEVKT 2    
16684767KAANDAGYFNDEM*APIEVKT 2    
16684767KAGLSLKDMDLVEVNEAFAPQYLAVERS 3    
16684767KDFTATDLSEFAAKA 2    
16684767KDGTVTAGNASGVADGAGAVIIASEDAVKK 2    
16684767KDM*DLVEVNEAFAPQYLAVERS 2    
16684767KDMDLVEVNEAFAPQYLAVERS 2    
16684767KEAEVVLCGGTESMSQAPYCVRN 3    
16684767KISREECDKYALQSQQRW 2    
16684767KQTMQVDEHARPQTTLEQLQKL 3    
16684767KTNVNGGAIALGHPLGGSGSRI 2    
16684767KVSPETVDSVIMGNVLQSSSDAIYLARH 3    
16684767REECDKYALQSQQRW 2    
16684767RITAHLVHELRR 2    
16684767RTPFGAYGGLLKD 2    
18614015(K)AANEAGYFNEEMAPIEVK(T)      peptide count: 32
18614015(K)AGLSLKDMDLIDVNEAFAPQFLSVQK(A)      peptide count: 11
18614015(K)ALDLDPSK(T)      peptide count: 58
18614015(K)ALDLDPSKTNVSGGAIALGHPLGGSGSR(I)      peptide count: 5
18614015(K)DFSATDLTEFAAR(A)      peptide count: 113
18614015(K)DGTVTAGNASGVSDGAGAVIIASEDAVK(K)      peptide count: 21
18614015(K)DGTVTAGNASGVSDGAGAVIIASEDAVKK(H)      peptide count: 9
18614015(K)DMDLIDVNEAFAPQFLSVQK(A)      peptide count: 96
18614015(K)FGLDLK(L)      peptide count: 36
18614015(K)FGLDLKLEDTLWAGLTDQHVK(L)      peptide count: 36
18614015(K)GKQTMQVDEHARPQTTLEQLQK(L)      peptide count: 6
18614015(K)HNFTPLAR(V)      peptide count: 50
18614015(K)KAGLSLK(D)      peptide count: 9
18614015(K)KAGLSLKDMDLIDVNEAFAPQFLSVQK(A)      peptide count: 2
18614015(K)KDGTVTAGNASGVSDGAGAVIIASEDAVKK(H)      peptide count: 2
18614015(K)KHNFTPLAR(V)      peptide count: 98
18614015(K)LEDTLWAGLTDQHVK(L)      peptide count: 39
18614015(K)LPMGMTAENLAAK(Y)      peptide count: 84
18614015(K)LPSVFK(K)      peptide count: 9
18614015(K)LPSVFKK(D)      peptide count: 11
18614015(K)QTMQVDEHARPQTTLEQLQK(L)      peptide count: 46
18614015(K)RTPFGAYGGLLK(D)      peptide count: 31
18614015(K)TNVSGGAIALGHPLGGSGSR(I)      peptide count: 101
18614015(K)VPPETIDSVIVGNVMQSSSDAAYLAR(H)      peptide count: 180
18614015(K)YAVGSACIGGGQGIALIIQNTA(-)      peptide count: 137
18614015(K)YNISR(E)      peptide count: 69
18614015(R)AALSAGK(V)      peptide count: 6
18614015(R)AALSAGK(V)      peptide count: 1
18614015(R)EDCDRYALQSQQR(W)      peptide count: 13
18614015(R)GVFIVAAK(R)      peptide count: 49
18614015(R)ITAHLVHELR(R)      peptide count: 126
18614015(R)ITAHLVHELRR(R)      peptide count: 35
18614015(R)LCGSGFQSIVSGCQEICSK(D)      peptide count: 6
18614015(R)TPFGAYGGLLK(D)      peptide count: 35
18614015(R)TPFGAYGGLLKDFSATDLTEFAAR(A)      peptide count: 1
18614015(R)VGVPTETGALTLNR(L)      peptide count: 134
18614015(R)VVGYFVSGCDPTIMGIGPVPAINGALK(K)      peptide count: 11
18614015(R)VVGYFVSGCDPTIMGIGPVPAINGALKK(A)      peptide count: 18
18614015(R)YALQSQQR(W)      peptide count: 79
15253431AANDAGYFNDEM*APIEVK 2   Pept_E (Sonar search): 3.70E-01 
15253431AANDAGYFNDEM*APIEVK 3   Pept_E (Sonar search): 7.40E-01 
15253431AANDAGYFNDEMAPIEVK 2   Pept_E (Sonar search): 1.20E-01 
15253431DFTATDLSEFAAK 2   Pept_E (Sonar search): 2.80E-04 
15253431DGTVTAGNASGVADGAGAVIIASEDAVK 3   Pept_E (Sonar search): 5.90E-05 
15253431DM*DLVEVNEAFAPQYLAVER 3   Pept_E (Sonar search): 1.30E-04 
15253431DMDLVEVNEAFAPQYLAVER 3   Pept_E (Sonar search): 2.00E-01 
15253431EAEVVLCGGTESMSQAPYCVR 3   Pept_E (Sonar search): 7.00E-03 
15253431EECDKYALQSQQR 3   Pept_E (Sonar search): 6.00E-02 
15253431ETPALTINR 2   Pept_E (Sonar search): 4.60E-02 
15253431HNFTPLAR 2    
15253431ITAHLVHELR 2   Pept_E (Sonar search): 9.50E-05 
15253431ITAHLVHELR 2    
15253431LCGSGFQSIVNGCQEICVK 3   Pept_E (Sonar search): 1.20E-01 
15253431SLDLDISK 2   Pept_E (Sonar search): 4.90E-02 
15253431SLDLDISK 2   Pept_E (Sonar search): 2.20E-01 
15253431TNVNGGAIALGHPLGGSGSR 3   Pept_E (Sonar search): 3.00E-02 
15253431TPFGAYGGLLK 2   Pept_E (Sonar search): 1.20E-04 
15253431TPFGAYGGLLK 1    
15253431VSPETVDSVIMGNVLQSSSDAIYLAR 3   Pept_E (Sonar search): 9.00E-01 
15253431VSPETVDSVIMGNVLQSSSDAIYLAR 2    
21616181AANEAGYFNEEMAPIEVK2287.11893 (observed)   N-Term(iTRAQ4plex), M12(Oxidation), K18(iTRAQ4plex)peptide count: 3
21616181AANEAGYFNEEMAPIEVK2271.12651 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 4
21616181AANEAGYFNEEMAPIEVK2271.12261 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 4
21616181DFSATDLTEFAAR1587.77982 (observed)   N-Term(iTRAQ4plex)peptide count: 3
21616181DGTVTAGNASGVSDGAGAVIIASEDAVK2820.45224 (observed)   N-Term(iTRAQ4plex), K28(iTRAQ4plex) peptide count: 1
21616181DMDLIDVNEAFAPQFLSVQK2584.32456 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), K20(iTRAQ4plex)peptide count: 5
21616181DMDLIDVNEAFAPQFLSVQK2568.33561 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex)peptide count: 3
21616181DMDLIDVNEAFAPQFLSVQK2568.33286 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex)peptide count: 3
21616181DMDLIDVNEAFAPQFLSVQK2584.33133 (observed)   N-Term(iTRAQ4plex), M2(Oxidation), K20(iTRAQ4plex)peptide count: 5
21616181LPMGMTAENLAAK1634.88982 (observed)   N-Term(iTRAQ4plex), K13(iTRAQ4plex)peptide count: 5
21616181TPFGAYGGLLK1411.83 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 2
21616181VGVPTETGALTLNR1571.89048 (observed)   N-Term(iTRAQ4plex)peptide count: 13
21616181VGVPTETGALTLNR1571.88799 (observed)   N-Term(iTRAQ4plex)peptide count: 18
21616181VPPETIDSVIVGNVMQSSSDAAYLAR2863.47416 (observed)   N-Term(iTRAQ4plex)peptide count: 4
21616181VPPETIDSVIVGNVMQSSSDAAYLAR2863.46848 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181VPPETIDSVIVGNVMQSSSDAAYLAR2879.46915 (observed)   N-Term(iTRAQ4plex), M15(Oxidation) peptide count: 1
21127740DFTATDLSEFAAK708.34 (observed)29.67E+0527.96 (HPLC [min or %B]) MS2 score: 45.61
21127740DFTATDLSEFAAK708.34 (observed)21.38E+0635.63 (HPLC [min or %B]) MS2 score: 61.55
21127740DFTATDLSEFAAK708.34 (observed)27.24E+0531.19 (HPLC [min or %B]) MS2 score: 74.29
21127740TPFGAYGGLLK562.31 (observed)21.63E+0635.42 (HPLC [min or %B]) MS2 score: 31.65
21127740YALQSQQR497.26 (observed)21.49E+069.09 (HPLC [min or %B]) MS2 score: 42.01
21127740YALQSQQR497.26 (observed)27.47E+0515.66 (HPLC [min or %B]) MS2 score: 38.98
18563753AANEAGUFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ4    
18563753AANEAGYFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ3    
18563753AANEAGYFNEEMAPIEVJ3    
18563753DAEVVLCGGTESMSQSPYSVR3    
18563753DAEVVLCGGTESMSQSPYSVR3    
18563753DAEVVLCGGTESMSQSPYSVR3    
18563753DFTATDLTEFAAR3    
18563753DFTATDLTEFAAR3    
18563753DFTATDLTEFAAR2    
18563753DFTATDLTEFAAR2    
18563753DFTATDLTEFAAR2    
18563753DFTATDLTEFAAR3    
18563753DFTATDLTEFAAR3    
23376485DGTVTAGNASGVADGAGAVIIASEDAVKK882.12 (observed)   ::::::::::::::::::::::::::::::
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ4    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753DMDLIDVNEAFAPQFLAVQJ3    
18563753FGLDLJ2    
18563753FGLDLJ2    
18563753FGLDLJ2    
18563753FGLDLJ2    
18563753FGLDLJ2    
18563753GJQTMQVDEHARPQTTLEQLQJ4    
18563753GJQTMQVDEHARPQTTLEQLQJ5    
18563753GJQTMQVDEHARPQTTLEQLQJ4    
18563753GVFIVAAJ2    
18563753GVFIVAAJ2    
18563753GVFIVAAJ2    
18563753ITAHLVHELR3    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR3    
18563753ITAHLVHELR3    
18563753ITAHLVHELR3    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR4    
18563753ITAHLVHELR3    
18563753ITAHLVHELR2    
18563753ITAHLVHELR4    
18563753ITAHLVHELRR3    
18563753ITAHLVHELRR3    
18563753ITAHLVHELRR4    
18563753ITAHLVHELRR4    
18563753ITAHLVHELRR3    
18563753ITAHLVHELRR4    
18563753ITAHLVHELRR3    
18563753ITAHLVHELRR4    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ2    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LEDTLWAGLTDQHVJ3    
18563753LPMGMTAENLAAJ2    
18563753LPMGMTAENLAAJ2    
18563753LPMGMTAENLAAJ3    
18563753LPMGMTAENLAAJ3    
18563753LPMGMTAENLAAJ3    
18563753LPMGMTAENLAAJ2    
18563753LPPVFJJ3    
18563753LPPVFJJ3    
18563753LPPVFJJ3    
18563753QTMQVDEHARPQTTLEQLQJ4    
18563753QTMQVDEHARPQTTLEQLQJ4    
18563753QTMQVDEHARPQTTLEQLQJ4    
18563753QTMQVDEHARPQTTLEQLQJ4    
18563753QTMQVDEHARPQTTLEQLQJ4    
18563753RTPFGAYGGLLJ3    
18563753RTPFGAYGGLLJ3    
18563753RTPFGAYGGLLJ3    
18563753RTPFGAYGGLLJ3    
18563753RTPFGAYGGLLJ3    
18563753RTPFGAYGGLLJ3    
18563753SLDLDPSJ2    
18563753SLDLDPSJ2    
18563753SLDLDPSJ2    
18563753SLDLDPSJ2    
18563753SLDLDPSJTNVSGGAIALGHPLGGSGSR4    
18563753TNVSGGAIALGHPLGGSGSR3    
18563753TNVSGGAIALGHPLGGSGSR3    
18563753TNVSGGAIALGHPLGGSGSR3    
18563753TNVSGGAIALGHPLGGSGSR3    
18563753TPFGAYGGLLJ3    
18563753TPFGAYGGLLJ3    
18563753TPFGAYGGLLJ3    
18563753TPFGAYGGLLJ3    
23376485TPFGAYGGLLK562.313 (observed)   ::::::::::::
18563753VGVPTETGALTLNR2    
18563753VGVPTETGALTLNR3    
18563753VGVPTETGALTLNR3    
18563753VGVPTETGALTLNR2    
18563753VGVPTETGALTLNR2    
18563753VGVPTETGALTLNR3    
18563753VPPETIDSVIVGNVMQSSSDAAYLAR3    
18563753VVGYFVSGCDPAIMGIGPVPAITGALJJ4    
18563753WJAANEAGYFNEEMAPIEVJ4    
18563753WJAANEAGYFNEEMAPIEVJ4    

Compile date 12-23-2014© PADB initiative