PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A7976ACAA1, ACAA, PTHIO3-ketoacyl-CoA thiolase, peroxisomal precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16446289KAEELGLPILGVLRS 2   peptide count: 1
18501002KDTTPDELLSAVLTAVLQDVKL 2    
16446289KDTTPDELLSAVMTAVLKD 2   peptide count: 1
18501002KLKPEQLGDISVGNVLQPGAGAIM*ARI 3    
18501002KLKPEQLGDISVGNVLQPGAGAIMARI 3    
18501002KLKPEQLGDISVGNVLQPGAGAIMARI 2    
18501002RDCLIPM*GITSENVAERF 2    
18501002RDCLIPMGITSENVAERF 2    
18501002RNGSYDIGMACGVESM*TLSQRG 2    
16684767CLSGAPQASAADVVVVHGRR 2    
16684767EKLRLPPEKVNPLGGAVALGHPLGCTGARQ 3    
16684767KAEELGLPILGVLRS 2    
16684767KAGLTVSDVDIFEINEAFASQAAYCVEKL 3    
16684767KARDCLIPMGITSENVAERF 2    
16684767KDGSTTAGNSSQVSDGAAAILLARR 2    
16684767KDVNLRPEQLGDICVGNVLQPGAGAIMARI 3    
16684767KGCFQAEIVPVTTTVHDDKGTKRS 3    
16684767KVNPLGGAVALGHPLGCTGARQ 2    
16684767RDCLIPM*GITSENVAERF 2    
16684767RDCLIPMGITSENVAERF 2    
16684767RGGFKDTTPDELLSAVMTAVLKD 2    
16684767RLPPEKVNPLGGAVALGHPLGCTGARQ 3    
16684767RNGSYDIGMACGVESMSLADRGNPGNITSRL 3    
16684767RQCSSGLQAVASIAGGIRN 2    
16684767RQVITLLNELKRR 2    
16684767RSKAEELGLPILGVLRS 2    
16684767RSYAVVGVPPDIMGIGPAYAIPVALQKA 2    
18614015(K)AEELGLPILGVLR(S)      peptide count: 13
18614015(K)DGGSTTAGNSSQVSDGAAAVLLAR(R)      peptide count: 3
18614015(K)DTTPDELLSAVLTAVLQDVK(L)      peptide count: 24
18614015(K)LGIPAEK(V)      peptide count: 5
18614015(K)LKPEQLGDISVGNVLQPGAGAIMAR(I)      peptide count: 5
18614015(K)QDAFALASQQK(A)      peptide count: 1
18614015(K)TITVSQDEGVRPSTTMQGLAK(L)      peptide count: 9
18614015(K)VNPLGGAIALGHPLGCTGAR(Q)      peptide count: 7
18614015(R)DCLIPMGITSENVAER(F)      peptide count: 1
18614015(R)GCFHAEIVPVTTTVLNDKGDK(K)      peptide count: 1
18614015(R)GCFHAEIVPVTTTVLNDKGDKK(T)      peptide count: 3
18614015(R)GCFKDTTPDELLSAVLTAVLQDVK(L)      peptide count: 9
18614015(R)GNHGNISSR(L)      peptide count: 5
18614015(R)IAQFLSGIPETVPLSTVNR(Q)      peptide count: 17
18614015(R)QCSSGLQAVANIAGGIR(N)      peptide count: 1
18614015(R)QKQDAFALASQQK(A)      peptide count: 8
18614015(R)QVVTLLNELK(R)      peptide count: 29
18614015(R)QVVTLLNELKR(R)      peptide count: 12
18614015(R)RTPIGR(A)      peptide count: 1
18614015(R)SKAEELGLPILGVLR(S)      peptide count: 3
18614015(R)SYAVVGVPPDVMGIGPAYAIPAALQK(A)      peptide count: 4

Compile date 12-23-2014© PADB initiative