PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A7909AARS2, AARSLProbable alanyl-tRNA synthetase, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(-)MLGARR(L)      peptide count: 1
18614015(K)HTATHLLSWALR(Q)      peptide count: 2
18614015(K)IASLVSEDEAAFLASLQR(G)      peptide count: 3
18614015(K)LDTAGLEQLAQK(E)      peptide count: 4
18614015(K)SQELLK(R)      peptide count: 1
18614015(R)AYALSQL(-)      peptide count: 1
18614015(R)DAFLSFFR(D)      peptide count: 12
18614015(R)DIWLSLGVPASR(V)      peptide count: 4
18614015(R)DLPEAHR(L)      peptide count: 3
18614015(R)EVGQSLSQEVEAASER(L)      peptide count: 3
18614015(R)FDVATQTLLTTEQLR(T)      peptide count: 2
18614015(R)GDPSLLFVNAGMNQFKPIFLGTVDPR(S)      peptide count: 6
18614015(R)GSHLNPER(L)      peptide count: 4
18614015(R)HNDLEDVGR(D)      peptide count: 4
18614015(R)HVDTGMGLER(L)      peptide count: 11
18614015(R)IDTAYR(V)      peptide count: 1
18614015(R)LLAITGEQAQQAR(E)      peptide count: 5
18614015(R)LTEVAESAVIPQWQR(Q)      peptide count: 1
18614015(R)LVPSATVRPR(G)      peptide count: 4
18614015(R)LWVSYFSGDSQTGLDPDLETR(D)      peptide count: 1
18614015(R)QGIPTTDDSPK(Y)      peptide count: 3
18614015(R)QTLGPTTEQR(G)      peptide count: 4
18614015(R)RANTAIR(K)      peptide count: 1
18614015(R)SEMAGFR(R)      peptide count: 1
18614015(R)SLDEVYPDPVR(V)      peptide count: 3
18614015(R)TNFYAEQGGQASDR(G)      peptide count: 3
18614015(R)TVESYVQEVVGQDKPVFMEEVPLAHTAR(I)      peptide count: 1
18614015(R)VGAADEGR(I)      peptide count: 1
18614015(R)VVADHIR(T)      peptide count: 7
18614015(R)VVAQGTGHTADLEAALGTAR(A)      peptide count: 9
18614015(R)YSTEVLQAPPGFLGSLVPVVVETLGSAYPELEK(N)      peptide count: 10

Compile date 12-23-2014© PADB initiative