PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A775BABCB6, MTABC3, PRPATP-binding cassette half-transporter

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)APDIILLDEATSALDTSNER(A)      peptide count: 6
18614015(K)DGCIIER(G)      peptide count: 2
18614015(K)DVPGAGPLR(F)      peptide count: 1
18614015(K)YYGAEGYEVDR(Y)      peptide count: 2
18614015(R)AIQASLAK(V)      peptide count: 1
18614015(R)AIQASLAK(V)      peptide count: 3
18614015(R)ALNVLVPIFYR(D)      peptide count: 6
18614015(R)AVDSLLNFETVK(Y)      peptide count: 9
18614015(R)DIVNLLTAK(A)      peptide count: 2
18614015(R)EVPAGPEELSWAAGPR(V)      peptide count: 3
18614015(R)FYDISSGCIR(I)      peptide count: 4
18614015(R)GRHEALLSR(G)      peptide count: 7
18614015(R)HEALLSR(G)      peptide count: 1
18614015(R)IDGQDISQVTQISLR(S)      peptide count: 3
18614015(R)LFSHLHELSLR(W)      peptide count: 1
18614015(R)LLSSYLWPR(G)      peptide count: 1
18614015(R)SHIGVVPQDTVLFNDTIANNIR(Y)      peptide count: 7
18614015(R)TFLWIR(V)      peptide count: 1
18614015(R)TTIVIAHR(L)      peptide count: 7
18614015(R)VAPYVLQLFLATLQMALPLAGLAGR(V)      peptide count: 21
18614015(R)VQQFTSR(G)      peptide count: 1
18614015(R)VQQFTSRGVELR(L)      peptide count: 1
18614015(R)VTAGDSEVEAAAQAAGIHDAILSFPEGYETQVGER(G)      peptide count: 2
21127740ALNVLVPIFYR652.89 (observed)26.57E+0540.75 (HPLC [min or %B]) MS2 score: 60.57
21127740ALNVLVPIFYR652.89 (observed)23.09E+0540.93 (HPLC [min or %B]) MS2 score: 33.84
21127740ALNVLVPIFYR652.89 (observed)25.26E+0540.55 (HPLC [min or %B]) MS2 score: 33.44
21127740ALNVLVPIFYR652.89 (observed)21.11E+0635.91 (HPLC [min or %B]) MS2 score: 43.26

Compile date 12-23-2014© PADB initiative