PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A772BABCA9ATP-binding cassette sub-family A member 9

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16316981LVDALKLQDQLKAPVK      peptide count: 1
16684767DPQVLLLDEPTAGLDPLSRHRI 2    
16684767SFN#DTNYVIAFAPESKTTQEIMNKVASAPFLKGRT 3    
18614015(K)DAVVTITRLVNALK(L)      peptide count: 1
18614015(K)GRTIVACPDEK(S)      peptide count: 1
18614015(K)LVYILPLER(T)      peptide count: 2
18614015(R)GLGFDIYEGQITALLGHSGAGK(T)      peptide count: 1

Compile date 12-23-2014© PADB initiative