PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A767BABCR, ABCA4Retinal-specific ATP-binding cassette transporter

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AVVIEK(A)      peptide count: 1
18614015(R)NEEAQDLSGGMQRK(L)      peptide count: 1
18614015(R)STEVLQDLTNR(N)      peptide count: 2
18614015(R)VMSGGNKTDILKLNELTKVYSGSSSPAVDR(L)      peptide count: 1

Compile date 12-23-2014© PADB initiative