PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A761CADAD2, TENRLAdenosine deaminase domain-containing protein 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16684767RALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPFTLKP4173.9423 (observed)3   peptide count: 1

Compile date 12-23-2014© PADB initiative