PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A7472ACPPProstatic acid phosphatase precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260ATQIPSYK-2.316540431 (delta mass [ppm])1   MS2 score: 41 
16948836ATQIPSYK0.2 (delta mass [ppm])1    
16948836ATQIPSYK1.4 (delta mass [ppm])2    
16948836ATQIPSYK3.1 (delta mass [ppm])2    
16316981ATQIPSYK      peptide count: 1
16316981ATQIPSYKK      peptide count: 1
16709260DFIATLGK0.935985169 (delta mass [ppm])2   MS2 score: 40 
16948836DFIATLGK1.2 (delta mass [ppm])2    
16948836DFIATLGK0.1 (delta mass [ppm])2    
16316981DFIATLGK      peptide count: 1
16948836DFIATLGKLSGLHGQDLFGIWSK2.1 (delta mass [ppm])3    
16316981EKSRLQGGVLVNEILNHMK      peptide count: 1
16901338ELSELSLLSLYGIHK2   MS2 score: 53 
16709260ELSELSLLSLYGIHK0.809554833 (delta mass [ppm])2   MS2 score: 80 
16948836ELSELSLLSLYGIHK1 (delta mass [ppm])2    
16948836ELSELSLLSLYGIHK0.4 (delta mass [ppm])2    
16948836ELSELSLLSLYGIHK2.2 (delta mass [ppm])2    
16709260ESSWPQGFGQLTQLGMEQHYELGEYIR-0.794035676 (delta mass [ppm])3   MS2 score: 31 
16948836ESSWPQGFGQLTQLGMEQHYELGEYIR4.6 (delta mass [ppm])3    
16316981ESSWPQGFGQLTQLGMEQHYELGEYIR      peptide count: 1
16948836FAELVGPVIPQDWSTECMTTNSHQGTEDSTD0.2 (delta mass [ppm])3    
16948836FAELVGPVIPQDWSTECMTTNSHQGTEDSTD4.2 (delta mass [ppm])3    
16948836FAELVGPVIPQDWSTECMTTNSHQGTEDSTD0.7 (delta mass [ppm])3    
16709260FLNESYK0.675643503 (delta mass [ppm])2   MS2 score: 34 
16948836FLNESYK0.8 (delta mass [ppm])2    
16709260FLNESYKHEQVYIR-0.802228792 (delta mass [ppm])2   MS2 score: 61 
16948836FLNESYKHEQVYIR0.3 (delta mass [ppm])2    
16709260FQELESETLK-0.211842212 (delta mass [ppm])2   MS2 score: 50 
16948836FQELESETLK0.7 (delta mass [ppm])2    
16948836FQELESETLK3.9 (delta mass [ppm])2    
16948836FQELESETLK1.8 (delta mass [ppm])2    
16709260FQELESETLKSEEFQK0.960959269 (delta mass [ppm])2   MS2 score: 92 
16948836FQELESETLKSEEFQK1.3 (delta mass [ppm])2    
16948836FQELESETLKSEEFQK2 (delta mass [ppm])2    
16316981FQELESETLKSEEFQK      peptide count: 7
16709260FQELESETLKSEEFQKR5.003647484 (delta mass [ppm])2   MS2 score: 76 
16948836FQELESETLKSEEFQKR0.3 (delta mass [ppm])3    
16316981FQELESETLKSEEFQKR      peptide count: 2
16901338FVTLVFR2   MS2 score: 33 
16709260FVTLVFR1.003614906 (delta mass [ppm])2   MS2 score: 40 
16948836FVTLVFR0.1 (delta mass [ppm])2    
16948836FVTLVFR1.1 (delta mass [ppm])2    
16948836FVTLVFR1.3 (delta mass [ppm])2    
16709260GEYFVEMYYR1.534392271 (delta mass [ppm])2   MS2 score: 65 
16948836GEYFVEMYYR2.1 (delta mass [ppm])2    
16948836GEYFVEMYYR2.7 (delta mass [ppm])2    
16948836GEYFVEMYYR1.7 (delta mass [ppm])2    
16709260HEQVYIR0.646855404 (delta mass [ppm])2   MS2 score: 27 
16948836HEQVYIR4.6 (delta mass [ppm])3    
16948836HEQVYIR2.8 (delta mass [ppm])2    
16316981HEQVYIR      peptide count: 2
16709260HGDRSPIDTFPTDPIK0.28413997 (delta mass [ppm])3   MS2 score: 55 
16948836HGDRSPIDTFPTDPIK1.2 (delta mass [ppm])2    
16316981HGDRSPIDTFPTDPIK      peptide count: 2
16709260HGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIR1.883540179 (delta mass [ppm])5   MS2 score: 64 
16709260KFLNESYKHEQVYIR-0.156169135 (delta mass [ppm])3   MS2 score: 44 
16709260LHPYKDFIATLGK-2.164693505 (delta mass [ppm])2   MS2 score: 53 
16948836LHPYKDFIATLGK0.4 (delta mass [ppm])2    
16948836LHPYKDFIATLGK4 (delta mass [ppm])3    
16316981LHPYKDFIATLGK      peptide count: 7
16948836LIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEK1.6 (delta mass [ppm])4    
16948836LIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEK1.3 (delta mass [ppm])4    
16709260LQGGVLVNEILNHMK-0.552915224 (delta mass [ppm])2   MS2 score: 77 
16948836LQGGVLVNEILNHMK0.1 (delta mass [ppm])2    
16948836LQGGVLVNEILNHMK2.1 (delta mass [ppm])2    
16948836LQGGVLVNEILNHMK1.1 (delta mass [ppm])3    
16316981LQGGVLVNEILNHMK      peptide count: 9
16709260LQGGVLVNEILNHMKR0.614832129 (delta mass [ppm])2   MS2 score: 52 
16709260LRELSELSLLSLYGIHK-0.508598466 (delta mass [ppm])3   MS2 score: 61 
16948836LRELSELSLLSLYGIHK2.6 (delta mass [ppm])3    
16709260LSGLHGQDLFGIWSK0.301171675 (delta mass [ppm])2   MS2 score: 64 
16948836LSGLHGQDLFGIWSK2 (delta mass [ppm])2    
16948836LSGLHGQDLFGIWSK4.3 (delta mass [ppm])2    
16948836LSGLHGQDLFGIWSK3.3 (delta mass [ppm])2    
16709260RATQIPSYK-1.761746134 (delta mass [ppm])2   MS2 score: 35 
16948836RATQIPSYK1.3 (delta mass [ppm])2    
16948836RATQIPSYK2.6 (delta mass [ppm])2    
16709260RATQIPSYKK0.307388122 (delta mass [ppm])3   MS2 score: 35 
16709260RLHPYKDFIATLGK0.248502599 (delta mass [ppm])2   MS2 score: 67 
16948836RLHPYKDFIATLGK1.7 (delta mass [ppm])2    
16709260SEEFQKR1.311831496 (delta mass [ppm])2   MS2 score: 46 
16948836SEEFQKR0.7 (delta mass [ppm])2    
16901338SPIDTFPTDPIK2   MS2 score: 47 
16709260SPIDTFPTDPIK-1.400335228 (delta mass [ppm])2   MS2 score: 59 
16948836SPIDTFPTDPIK0.8 (delta mass [ppm])2    
16948836SPIDTFPTDPIK4 (delta mass [ppm])2    
16948836SPIDTFPTDPIK1.8 (delta mass [ppm])2    
16316981SPIDTFPTDPIK      peptide count: 15
16709260SPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIR4.691742356 (delta mass [ppm])4   MS2 score: 32 
16709260SPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRK-0.885284544 (delta mass [ppm])5   MS2 score: 34 
16709260SRLQGGVLVNEILNHMK-0.55187955 (delta mass [ppm])2   MS2 score: 69 
16709260SRLQGGVLVNEILNHMKR0.855975932 (delta mass [ppm])3   MS2 score: 70 
16948836TLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFR2.7 (delta mass [ppm])4    
16948836TLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFR2.3 (delta mass [ppm])4    
16316981VYDPLYCESVHNFTLPSWATEDTMTK      peptide count: 2
18361515K.LSGLHGQDLFGIWSK.V829.44 (observed)2    
18361515K.LSGLHGQDLFGIWSK.V829.44 (observed)2    
18361515K.LSGLHGQDLFGIWSK.V829.44 (observed)2    
18361515R.LQGGVLVNEILNHMK.R832.46 (observed)2    
18361515R.LQGGVLVNEILNHMK.R832.46 (observed)2    
18361515R.LQGGVLVNEILNHMK.R832.46 (observed)2    
21127740FVTLVFR441.27 (observed)27.72E+0527.62 (HPLC [min or %B]) MS2 score: 30.33
21127740FVTLVFR441.27 (observed)21.28E+0636.16 (HPLC [min or %B]) MS2 score: 39.37
21127740FVTLVFR441.26 (observed)21.80E+0627.54 (HPLC [min or %B]) MS2 score: 37.71
21127740FVTLVFR441.27 (observed)21.69E+0536.11 (HPLC [min or %B]) MS2 score: 23.77
21127740FVTLVFR441.27 (observed)26.82E+0436.22 (HPLC [min or %B]) MS2 score: 26.26
21127740FVTLVFR441.27 (observed)22.27E+0627.83 (HPLC [min or %B]) MS2 score: 48.76
21127740FVTLVFR441.27 (observed)22.48E+0628.66 (HPLC [min or %B]) MS2 score: 41.59
21127740DFIATLGK432.74 (observed)21.70E+0622.47 (HPLC [min or %B]) MS2 score: 34.85
21127740DFIATLGK432.75 (observed)22.47E+0622.31 (HPLC [min or %B]) MS2 score: 37.31
21127740DFIATLGK432.74 (observed)28.40E+0522.61 (HPLC [min or %B]) MS2 score: 30.3
21127740DFIATLGK432.74 (observed)25.85E+0631.03 (HPLC [min or %B]) MS2 score: 34.73
21127740ELSELSLLSLYGIHK567.99 (observed)31.26E+0633.65 (HPLC [min or %B]) MS2 score: 35.61
21127740ELSELSLLSLYGIHK567.99 (observed)34.11E+0634.07 (HPLC [min or %B]) MS2 score: 38.98
21127740ELSELSLLSLYGIHK567.99 (observed)37.34E+0534.11 (HPLC [min or %B]) MS2 score: 26.81
21127740ELSELSLLSLYGIHK567.99 (observed)34.84E+0534.31 (HPLC [min or %B]) MS2 score: 24.71
21127740ELSELSLLSLYGIHK567.99 (observed)32.62E+0634.16 (HPLC [min or %B]) MS2 score: 35.72
21127740ELSELSLLSLYGIHK851.47 (observed)21.67E+0635.21 (HPLC [min or %B]) MS2 score: 64.68
21127740ELSELSLLSLYGIHK567.99 (observed)35.68E+0534.19 (HPLC [min or %B]) MS2 score: 22.17
21127740ELSELSLLSLYGIHK567.98 (observed)31.42E+0642.02 (HPLC [min or %B]) MS2 score: 35.13
21127740ELSELSLLSLYGIHK567.98 (observed)31.39E+0641.38 (HPLC [min or %B]) MS2 score: 24.72
21127740ELSELSLLSLYGIHK567.98 (observed)33.95E+0542.05 (HPLC [min or %B]) MS2 score: 25.44
21127740ELSELSLLSLYGIHK567.99 (observed)37.16E+0536.6 (HPLC [min or %B]) MS2 score: 33.8
21127740ELSELSLLSLYGIHK567.99 (observed)31.13E+0636.7 (HPLC [min or %B]) MS2 score: 27.9
21127740ELSELSLLSLYGIHK567.99 (observed)38.90E+0536.67 (HPLC [min or %B]) MS2 score: 29.65
21127740FQELESETLK612.31 (observed)29.67E+0525.82 (HPLC [min or %B]) MS2 score: 27.98
21127740FQELESETLK612.31 (observed)28.77E+0525.46 (HPLC [min or %B]) MS2 score: 29.92
21127740FQELESETLK612.31 (observed)27.39E+0518.15 (HPLC [min or %B]) MS2 score: 42.78
21127740FVTLVFR441.26 (observed)28.45E+0536.2 (HPLC [min or %B]) MS2 score: 38
21127740FVTLVFR441.26 (observed)23.68E+0636.89 (HPLC [min or %B]) MS2 score: 40.89
21127740FVTLVFR441.27 (observed)21.83E+0635.9 (HPLC [min or %B]) MS2 score: 37.53
21127740FVTLVFR441.27 (observed)21.32E+0626.58 (HPLC [min or %B]) MS2 score: 51.7
21127740FVTLVFR441.27 (observed)22.01E+0626.86 (HPLC [min or %B]) MS2 score: 40.68
21127740FVTLVFR441.27 (observed)23.77E+0527.75 (HPLC [min or %B]) MS2 score: 34.51
21127740FVTLVFR441.27 (observed)25.99E+0537.03 (HPLC [min or %B]) MS2 score: 29.53
21127740FVTLVFR441.27 (observed)26.86E+0530.92 (HPLC [min or %B]) MS2 score: 35.6
21127740FVTLVFR441.27 (observed)23.41E+0531.02 (HPLC [min or %B]) MS2 score: 12.01
21127740FVTLVFR441.26 (observed)23.25E+0631.37 (HPLC [min or %B]) MS2 score: 37.78
21127740FVTLVFR441.27 (observed)21.95E+0631.4 (HPLC [min or %B]) MS2 score: 45.49
21127740FVTLVFR441.27 (observed)21.44E+0631.68 (HPLC [min or %B]) MS2 score: 42.68
21127740FVTLVFR441.27 (observed)22.49E+0631.87 (HPLC [min or %B]) MS2 score: 32.15
21127740FVTLVFR441.27 (observed)21.33E+0629.5 (HPLC [min or %B]) MS2 score: 35.1
21127740FVTLVFR441.26 (observed)22.10E+0631.12 (HPLC [min or %B]) MS2 score: 39.1
21127740FVTLVFR441.26 (observed)25.34E+0630.66 (HPLC [min or %B]) MS2 score: 41.01
21127740FVTLVFR441.27 (observed)21.31E+0626.68 (HPLC [min or %B]) MS2 score: 42.67
21127740FVTLVFR441.27 (observed)23.17E+0526.69 (HPLC [min or %B]) MS2 score: 14.29
21127740FVTLVFR441.27 (observed)22.15E+0630.95 (HPLC [min or %B]) MS2 score: 45.74
21127740FVTLVFR441.27 (observed)21.29E+0631.04 (HPLC [min or %B]) MS2 score: 48.27
21127740FVTLVFR441.27 (observed)21.98E+0630.96 (HPLC [min or %B]) MS2 score: 42.83
21127740LSGLHGQDLFGIWSK553.3 (observed)31.21E+0638.49 (HPLC [min or %B]) MS2 score: 30.17
21127740LSGLHGQDLFGIWSK553.3 (observed)33.59E+0631.3 (HPLC [min or %B]) MS2 score: 30.92
21127740LSGLHGQDLFGIWSK553.3 (observed)34.24E+0632.57 (HPLC [min or %B]) MS2 score: 33.67
21127740SPIDTFPTDPIK665.85 (observed)25.83E+0524.27 (HPLC [min or %B]) MS2 score: 34.89
21127740SPIDTFPTDPIK665.85 (observed)22.32E+0631.94 (HPLC [min or %B]) MS2 score: 35.08
21127740SPIDTFPTDPIK665.85 (observed)22.46E+0624.35 (HPLC [min or %B]) MS2 score: 55.37
21127740SPIDTFPTDPIK665.85 (observed)24.33E+0531.84 (HPLC [min or %B]) MS2 score: 39.46
21127740SPIDTFPTDPIK665.85 (observed)21.54E+0624.51 (HPLC [min or %B]) MS2 score: 44.89
21127740SPIDTFPTDPIK665.85 (observed)23.39E+0625.03 (HPLC [min or %B]) MS2 score: 51.19
21127740SPIDTFPTDPIK665.85 (observed)21.81E+0631.66 (HPLC [min or %B]) MS2 score: 41.13
21127740ELSELSLLSLYGIHK567.99 (observed)31.11E+0636.72 (HPLC [min or %B]) MS2 score: 22.38
21127740ELSELSLLSLYGIHK567.99 (observed)33.82E+0533.57 (HPLC [min or %B]) MS2 score: 23.56
21127740ELSELSLLSLYGIHK567.98 (observed)32.09E+0636.94 (HPLC [min or %B]) MS2 score: 30.41
21127740ELSELSLLSLYGIHK567.99 (observed)31.12E+0533.61 (HPLC [min or %B]) MS2 score: 27.64
21127740ELSELSLLSLYGIHK567.99 (observed)37.28E+0633.12 (HPLC [min or %B]) MS2 score: 32.74
21127740FQELESETLK612.31 (observed)21.16E+0620.98 (HPLC [min or %B]) MS2 score: 27.87
21127740FVTLVFR441.27 (observed)21.54E+0631.11 (HPLC [min or %B]) MS2 score: 28.85
21127740FVTLVFR441.27 (observed)28.75E+0527.01 (HPLC [min or %B]) MS2 score: 27.4
21127740GEYFVEMYYR686.8 (observed)29.66E+0525.81 (HPLC [min or %B])Oxidation (M)MS2 score: 54.9
21127740HEQVYIR472.75 (observed)21.76E+0615.66 (HPLC [min or %B]) MS2 score: 31.16
UNPUBLISHED_1K.DFIATLGKLSGLHGQDLFGIWSK.V    MS2 score: 2   
UNPUBLISHED_1K.FVTLVFR.H    MS2 score: 27   
UNPUBLISHED_1K.FVTLVFR.H    MS2 score: 9   
UNPUBLISHED_1K.LSGLHGQDLFGIWSK.V    MS2 score: 14   
UNPUBLISHED_1K.LSGLHGQDLFGIWSK.V    MS2 score: 17   
UNPUBLISHED_1K.LSGLHGQDLFGIWSK.V    MS2 score: 15   
UNPUBLISHED_1K.SRLQGGVLVNEILNHMK.R    MS2 score: 1   
21127740LQGGVLVNEILNHMK555.64 (observed)38.62E+0538.45 (HPLC [min or %B]) MS2 score: 43.77
21127740LQGGVLVNEILNHMK555.64 (observed)33.86E+0535.39 (HPLC [min or %B]) MS2 score: 31.91
21127740LQGGVLVNEILNHMK555.64 (observed)37.10E+0543.32 (HPLC [min or %B]) MS2 score: 23.26
21127740LRELSELSLLSLYGIHK657.71 (observed)31.57E+0635.66 (HPLC [min or %B]) MS2 score: 50.87
21127740LSGLHGQDLFGIWSK829.44 (observed)21.27E+0633.97 (HPLC [min or %B]) MS2 score: 55.85
21127740LSGLHGQDLFGIWSK553.29 (observed)31.42E+0630.42 (HPLC [min or %B]) MS2 score: 25.21
21127740LSGLHGQDLFGIWSK553.29 (observed)31.61E+0634.03 (HPLC [min or %B]) MS2 score: 25.53
21127740LSGLHGQDLFGIWSK553.29 (observed)32.30E+0631.09 (HPLC [min or %B]) MS2 score: 37.99
21127740LSGLHGQDLFGIWSK829.44 (observed)26.64E+0534.22 (HPLC [min or %B]) MS2 score: 42.08
21127740LSGLHGQDLFGIWSK553.3 (observed)35.07E+0630 (HPLC [min or %B]) MS2 score: 31.17
UNPUBLISHED_1M.RAAPLLLAR.A    MS2 score: 2   
UNPUBLISHED_1R.ATQIPSYKK.L    MS2 score: 5   
UNPUBLISHED_1R.ATQIPSYKK.L    MS2 score: 1   
UNPUBLISHED_1R.ELSELSLLSLYGIHK.Q    MS2 score: 6   
UNPUBLISHED_1R.FQELESETLKSEEFQK.R    MS2 score: 44   
UNPUBLISHED_1R.FQELESETLKSEEFQK.R    MS2 score: 41   
UNPUBLISHED_1R.FQELESETLKSEEFQK.R    MS2 score: 31   
UNPUBLISHED_1R.FQELESETLKSEEFQK.R    MS2 score: 27   
UNPUBLISHED_1R.FQELESETLKSEEFQK.R    MS2 score: 43   
UNPUBLISHED_1R.SPIDTFPTDPIK.E    MS2 score: 7   
21127740SPIDTFPTDPIK665.85 (observed)23.12E+0627.44 (HPLC [min or %B]) MS2 score: 40.24
21127740SPIDTFPTDPIK665.85 (observed)21.54E+0627.9 (HPLC [min or %B]) MS2 score: 42.81
21127740SPIDTFPTDPIK665.85 (observed)27.56E+0524.16 (HPLC [min or %B]) MS2 score: 36.04
21127740SPIDTFPTDPIK665.85 (observed)26.01E+0526.99 (HPLC [min or %B]) MS2 score: 45.37
21127740SPIDTFPTDPIK665.85 (observed)23.52E+0623.61 (HPLC [min or %B]) MS2 score: 40.63
23376485DFIATLGK432.747 (observed)   :::::::::
23376485ELSELSLLSLYGIHK851.477 (observed)   ::::::::::::::::
23376485ELSELSLLSLYGIHK851.48 (observed)   ::::::::::::::::
23376485ELSELSLLSLYGIHK851.482 (observed)   ::::::::::::::::
23376485ELSELSLLSLYGIHK851.481 (observed)   ::::::::::::::::
23376485FQELESETLK612.313 (observed)   :::::::::::
23376485FQELESETLK612.312 (observed)   :::::::::::
23376485FQELESETLK612.312 (observed)   :::::::::::
23376485FQELESETLK612.312 (observed)   :::::::::::
23376485FQELESETLK612.314 (observed)   :::::::::::
23376485FQELESETLK612.314 (observed)   :::::::::::
23376485FQELESETLK612.313 (observed)   :::::::::::
23376485FQELESETLK612.313 (observed)   :::::::::::
23376485FQELESETLK612.311 (observed)   :::::::::::
23376485FQELESETLK612.314 (observed)   :::::::::::
23376485FQELESETLK612.315 (observed)   :::::::::::
23376485FQELESETLK612.315 (observed)   :::::::::::
23376485FQELESETLK612.312 (observed)   :::::::::::
23376485FQELESETLKSEEFQK657.995 (observed)   :::::::::::::::::
23376485FVTLVFR441.266 (observed)   ::::::::
23376485FVTLVFR441.266 (observed)   ::::::::
23376485FVTLVFR441.267 (observed)   ::::::::
23376485FVTLVFR441.267 (observed)   ::::::::
23376485FVTLVFR441.267 (observed)   ::::::::
23376485FVTLVFR441.268 (observed)   ::::::::
23376485GEYFVEMYYR678.801 (observed)   :::::::::::
23376485LHPYKDFIATLGK751.924 (observed)   ::::::::::::::
23376485LHPYKDFIATLGK751.926 (observed)   ::::::::::::::
23376485LQGGVLVNEILNHMK840.959 (observed)   ::::::::::::::Oxidation_M::
23376485LQGGVLVNEILNHMK840.96 (observed)   ::::::::::::::Oxidation_M::
23376485LQGGVLVNEILNHMK832.964 (observed)   ::::::::::::::::
23376485LQGGVLVNEILNHMK555.644 (observed)   ::::::::::::::::
23376485LQGGVLVNEILNHMK832.97 (observed)   ::::::::::::::::
23376485LQGGVLVNEILNHMK555.648 (observed)   ::::::::::::::::
23376485LQGGVLVNEILNHMKR460.009 (observed)   ::::::::::::::Oxidation_M:::
23376485LRELSELSLLSLYGIHK657.719 (observed)   ::::::::::::::::::
23376485LRELSELSLLSLYGIHK657.715 (observed)   ::::::::::::::::::
23376485LSGLHGQDLFGIWSK829.444 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.441 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.441 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.446 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.439 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.445 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.443 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK553.299 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.443 (observed)   ::::::::::::::::
23376485LSGLHGQDLFGIWSK829.443 (observed)   ::::::::::::::::
23376485SPIDTFPTDPIK665.851 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.849 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.85 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.85 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.849 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.848 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.851 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.851 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.849 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.851 (observed)   :::::::::::::
23376485SPIDTFPTDPIK665.853 (observed)   :::::::::::::

Compile date 12-23-2014© PADB initiative