PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A7469ACP6, ACPL1, LPAPLysophosphatidic acid phosphatase type 6

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KNYVEDIPFLSPVYNPQEVFIRS 2    
18501002KVGMQQMFALGEKL 2    
18501002RFDYTVTNLAGGPKPHSHYDTEYRK 3    
18501002RKNYVEDIPFLSPVYNPQEVFIRS 3    
18501002RSPLKPLPLEEQVEWNPKL 3    
18501002RSPLKPLPLEEQVEWNPKL 2    
18614015(K)AAISQPGISEDLEK(V)      peptide count: 4
18614015(K)FLNTMSVYSVSPEK(Y)      peptide count: 2
18614015(K)MYLYATHDVTLLPMLLALGIFDQK(W)      peptide count: 1
18614015(K)NYVEDIPFLSPVYNPQEVFIR(S)      peptide count: 15
18614015(K)TGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPALER(F)      peptide count: 1
18614015(K)TGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPALER(F)      peptide count: 6
18614015(K)TVDPTTAPSK(T)      peptide count: 23
18614015(K)VGMQQMFALGEK(L)      peptide count: 3
18614015(R)APNGQRPVDR(N)      peptide count: 1
18614015(R)AVDMALYVVEQEDR(E)      peptide count: 1
18614015(R)AVDMALYVVEQEDRESIQMAVGPFLHILEGNLLK(T)      peptide count: 3
18614015(R)ESIQMAVGPFLHILEGNLLK(T)      peptide count: 4
18614015(R)FAQLIEQR(A)      peptide count: 40
18614015(R)GGVLAGQLTK(V)      peptide count: 6
18614015(R)SPLKPLPLEEQVEWNPK(L)      peptide count: 6
18578523EDRESLQMAVGPFLHILESNLLK3   
18578523EDRESLQMAVGPFLHILESNLLK3   
18578523QTASLQPGISEDLKK2   
18578523QTASLQPGISEDLKK2   
18578523VGMQQMFALGER2   

Compile date 12-23-2014© PADB initiative