PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A6740ADHFE1, HMFT2263Hydroxyacid-oxoacid transdehydrogenase, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AANLYASSPHSEFLDYVNAPIGK(G)      peptide count: 4
18614015(K)FLFDLNVDDGLAALGYSK(D)      peptide count: 7
18614015(K)FLFDLNVDDGLAALGYSKDDIPSLVK(G)      peptide count: 3
18614015(K)GKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLK(V)      peptide count: 2
18614015(K)GTLPQER(V)      peptide count: 8
18614015(K)NLSQLPPVQIVMDSLSK(N)      peptide count: 7
18614015(K)NVCLMTDK(N)      peptide count: 1
18614015(K)TADYAFEMAVSNIR(Y)      peptide count: 2
18614015(R)AQSEEDLSALFEASMK(L)      peptide count: 1
18614015(R)HLETAGILGANIR(T)      peptide count: 1
18614015(R)IQDAGLVLADALR(K)      peptide count: 9
18614015(R)IQDAGLVLADALRK(F)      peptide count: 3
18614015(R)KFLFDLNVDDGLAALGYSK(D)      peptide count: 1
18614015(R)NPDDLEAR(S)      peptide count: 7
18614015(R)VEPTDGSFMDAIEFAK(K)      peptide count: 1
18614015(R)YGAGVTK(E)      peptide count: 2

Compile date 12-23-2014© PADB initiative