PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A6552ABAT, GABAT4-aminobutyrate aminotransferase, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KIDIPSFDWPIAPFPRL 2    
18501002KLVQQPQNASTFINRPALGILPPENFVDKL 3    
18501002KTLLTGLLDLQAQYPQFISRV 2    
18501002KVDIEFDYDGPLM*KT 2    
18501002KVDIEFDYDGPLMKT 2    
18501002KVDIEFDYDGPLMKTEVPGPRSKE 3    
16948836NLLLAEVINIIK0.7 (delta mass [ppm])2    
18501002RLKYPLEEFTTDNQQEEARC 3    
18501002RLKYPLEEFTTDNQQEEARC 2    
18501002RM*LDLYSQISSVPIGYNHPALAKL 3    
18501002RMLDLYSQISSVPIGYNHPALAKL 3    
18501002RMLDLYSQISSVPIGYNHPALAKL 2    
18501002RTVAGIIVEPIQSEGGDNHASDDFFRK 3    
16684767KAIHKIDIPSFDWPIAPFPRL 3    
16684767KALLTGLLDLQARY 2    
16684767KGMSQLITMACGSCSNENALKT 2    
16684767KGVVLGGCGDKS 2    
16684767KLIQQPQNASMFVNRPALGILPPENFVEKL 3    
16684767KNLLLAEVINIIKR 2    
16684767KQLNIIQNAEAVHFFCNYEESRG 3    
16684767RCLEEVEDLIVKY 2    
16684767RGFSQEELETCMINQAPGCPDYSILSFMGAFHGRT 3    
16684767RGTFCSFDTPDDSIRN 2    
16684767RKHGCAFLVDEVQTGGGCTGKF 2    
16684767RMLDLYSQISSVPIGYSHPALLKL 3    
16684767RNKGVVLGGCGDKS 2    
16684767RTMGCLATTHSKA 2    
18614015(K)AIHKIDIPSFDWPIAPFPR(L)      peptide count: 3
18614015(K)EEFRPSAPYR(I)      peptide count: 33
18614015(K)EELETCMVNQSPGCPDYSILSFMGAFHGR(T)      peptide count: 1
18614015(K)FWAHEHWGLDDPADVMTFSK(K)      peptide count: 4
18614015(K)GVVLGGCGDK(S)      peptide count: 19
18614015(K)HGCAFLVDEVQTGGGCTGK(F)      peptide count: 3
18614015(K)IDIPSFDWPIAPFPR(L)      peptide count: 89
18614015(K)KMMTGGFFHK(E)      peptide count: 5
18614015(K)KMMTGGFFHKEEFRPSAPYR(I)      peptide count: 1
18614015(K)LILIAR(N)      peptide count: 22
18614015(K)LQESLMSVAPR(G)      peptide count: 11
18614015(K)LRDIAR(K)      peptide count: 3
18614015(K)LVQQPQNASTFINRPALGILPPENFVDK(L)      peptide count: 4
18614015(K)MMTGGFFHK(E)      peptide count: 3
18614015(K)MMTGGFFHKEEFRPSAPYR(I)      peptide count: 1
18614015(K)NLLLAEVINIIK(R)      peptide count: 283
18614015(K)NLLLAEVINIIKR(E)      peptide count: 7
18614015(K)QLNTIQNAEAVHFFCNYEESR(G)      peptide count: 6
18614015(K)REDLLNNVAR(V)      peptide count: 47
18614015(K)TEVPGPR(S)      peptide count: 16
18614015(K)TIFMWYR(S)      peptide count: 18
18614015(K)TLLTGLLDLQAQYPQFISR(V)      peptide count: 217
18614015(K)VDIEFDYDGPLMK(T)      peptide count: 8
18614015(K)YPLEEFTTDNQQEEAR(C)      peptide count: 1
18614015(R)CLEEVEDLIVK(Y)      peptide count: 12
18614015(R)DHHAHLFLSIFSGILADFK(-)      peptide count: 5
18614015(R)EDLLNNVAR(V)      peptide count: 9
18614015(R)FRPTLVFR(D)      peptide count: 25
18614015(R)GFSKEELETCMVNQSPGCPDYSILSFMGAFHGR(T)      peptide count: 1
18614015(R)GMSQLITMACGSCSNENAFK(T)      peptide count: 4
18614015(R)GNYLVDVDGNR(M)      peptide count: 31
18614015(R)GRGTFCSFDTPDEAIR(N)      peptide count: 1
18614015(R)GTFCSFDTPDEAIR(N)      peptide count: 19
18614015(R)IFNTWLGDPSK(N)      peptide count: 12
18614015(R)IFNTWLGDPSKNLLLAEVINIIK(R)      peptide count: 1
18614015(R)ILLLAR(V)      peptide count: 5
18614015(R)KHGCAFLVDEVQTGGGCTGK(F)      peptide count: 8
18614015(R)LKYPLEEFTTDNQQEEAR(C)      peptide count: 4
18614015(R)MLDLYSQISSVPIGYNHPALAK(L)      peptide count: 42
18614015(R)NKGVVLGGCGDK(S)      peptide count: 7
18614015(R)NKLILIAR(N)      peptide count: 1
18614015(R)SKELMK(Q)      peptide count: 5
18614015(R)TMGCLATTHSK(A)      peptide count: 13
18614015(R)TVAGIIVEPIQSEGGDNHASDDFFR(K)      peptide count: 32
18614015(R)TVAGIIVEPIQSEGGDNHASDDFFRK(L)      peptide count: 2
18614015(R)VGKTLLTGLLDLQAQYPQFISR(V)      peptide count: 2
21616181GTFCSFDTPDEAIR1748.77556 (observed)   N-Term(iTRAQ4plex), C4(Methylthio)peptide count: 3
21127740ALLTGLLDLQAR642.39 (observed)27.58E+0534.98 (HPLC [min or %B]) MS2 score: 80.48
23376485NLLLAEVINIIK676.935 (observed)   :::::::::::::

Compile date 12-23-2014© PADB initiative