PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5881ADAMTS13, UNQ6102/PRO20085, vWF-CPA disintegrin-like and metalloprotease (Reprolysin type) with thrombospondin type 1 motif, 13 preproprotein

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16684767KAVACTFARE 2    
16684767KM*SISPN#TTYPSLLEDGRV 2    
16684767KRGDSFLDGTRC 2    
16684767KTQLEFMSQQCART 2    
16684767RAGAQQPAVALETCNPQPCPARW 2    
16684767RAGLAWSPCSRR 2    
16684767RAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRW 3    
16684767RCGRPGGGVLLRY 2    
16684767RCVEAQGSLLKT 2    
16684767RDTCLGPQAQAPVPADFCQHLPKPVTVRG 3    
16684767RECDMQLFGPWGEIVSPSLSPATSNAGGCRL 3    
16684767REHLDMCQALSCHTDPLDQSSCSRL 3    
16684767REVCQAVPCPARW 2    
16684767RFLCMDSALRVPVQEELCGLASKPGSRR 3    
16684767RGPGQADCAVAIGRP 2    
16684767RGPGQADCAVAIGRPLGEVVTLRV 3    
16684767RIAIHALATNM*GAGTEGAN#ASYILIRD 3    
16684767RIAIHALATNMGAGTEGAN#ASYILIRD 3    
16684767RIWGPLQEDADIQVYRR 2    
16684767RLLVPLLDGTECGVEKW 2    
16684767RREVCQAVPCPARW 2    
16684767RRLLPGPQENSVQSSACGRQ 2    
16684767RRQLLSLLSAGRA 2    
16684767RSLVELTPIAAVHGRW 2    
16684767RSSPGGASFYHWGAAVPHSQGDALCRH 2    
16684767RVLESSLN#CSAGDMLLLWGRL 2    
16684767RVPVQEELCGLASKPGSRR 2    
16684767RYGEEYGN#LTRPDITFTYFQPKP 3    
16684767RYGEEYGN#LTRPDITFTYFQPKPRQ 3    

Compile date 12-23-2014© PADB initiative