PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5878ADAMTS1, METH1ADAMTS-1 precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260ASFGSGPAVEWIPK-1.738727189 (delta mass [ppm])2   MS2 score: 40 
16709260DAEHYDTAILFTR1.143327717 (delta mass [ppm])2   MS2 score: 47 
16709260GIGYFFVLQPK0.997084151 (delta mass [ppm])2   MS2 score: 31 
16709260GPEVTSNAALTLR-0.5453 (delta mass [ppm])2   MS2 score: 58 
16709260HFIDFCTMAECS-0.824223743 (delta mass [ppm])2   MS2 score: 49 
16709260HYLLTLFSVAAR-1.446994932 (delta mass [ppm])2   MS2 score: 57 
16709260ILVIHDEQK0.442569675 (delta mass [ppm])2   MS2 score: 50 
16709260ILVIHDEQKGPEVTSNAALTLR1.841625156 (delta mass [ppm])3   MS2 score: 66 
16948836LHAFDQQLDLELRPDSSFLAPGFTLQNVGR1.2 (delta mass [ppm])4    
16948836LLIYVASSR1.2 (delta mass [ppm])2    
16709260LYKHPSIR0.858202307 (delta mass [ppm])2   MS2 score: 27 
16709260NNGSFLAIK-0.35671937 (delta mass [ppm])2   MS2 score: 61 
16709260NSVSLVVVK0.337653747 (delta mass [ppm])2   MS2 score: 41 
16948836NSVSLVVVK0.2 (delta mass [ppm])2    
16709260QCQFTFGEDSK2.675464343 (delta mass [ppm])2   MS2 score: 41 
16709260QHNPPSDRDAEHYDTAILFTR-1.932186144 (delta mass [ppm])3   MS2 score: 27 
16709260YVETMLVADQSMAEFHGSGLK-0.187277124 (delta mass [ppm])3   MS2 score: 35 
16684767RLHAFDQQLDLELRPDSSFLAPGFTLQNVGRK3386.7616 (observed)3   peptide count: 2
18614015(R)NFCNWQKQHNSPSDR(D)      peptide count: 1
18578523HFIDFCTMAECS2   
18578523HFIDFCTMAECS2   
18578523HFIDFCTMAECS2   
18578523HFIDFCTMAECS2   
18578523HFIDFCTMAECS2   
18578523LHAFDQQLDLELRPDSSFLAPGFTLQNVGR3   
18578523LHAFDQQLDLELRPDSSFLAPGFTLQNVGR3   
18578523LHAFDQQLDLELRPDSSFLAPGFTLQNVGR3   
18578523LHAFDQQLDLELRPDSSFLAPGFTLQNVGR3   
18578523LHAFDQQLDLELRPDSSFLAPGFTLQNVGR3   
18578523SCSVIEDDGLQAAFTTAHELGHVFNMPHDDAK3   
21127740GIGYFFVLQPK634.86 (observed)23.80E+0535.09 (HPLC [min or %B]) MS2 score: 36.02

Compile date 12-23-2014© PADB initiative