PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5732ADH5, ADHX, FDHAlcohol dehydrogenase class III chi chain

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260AFQLMHSGK1.607280468 (delta mass [ppm])2   MS2 score: 38 
16901338AGDTVIPLYIPQCGECK2   MS2 score: 46 
16901338IDPLAPLDK2   MS2 score: 21 
16948836IIGVDINK0.8 (delta mass [ppm])2    
16901338IIGVDINKDK2   MS2 score: 41 
16709260IIGVDINKDK1.541791835 (delta mass [ppm])2   MS2 score: 28 
16948836IIGVDINKDK1.8 (delta mass [ppm])2    
18501002KAAVAWEAGKPLSIEEIEVAPPKA 2    
18501002KAAVAWEAGKPLSIEEIEVAPPKAHEVRI 3    
18501002KAGDTVIPLYIPQCGECKF 2    
18501002KIDPSAPLDKVCLLGCGISTGYGAAVNTAKV 3    
18501002KVCLLGCGISTGYGAAVNTAKV 2    
18501002KVDEFVTGNLSFDQINQAFDLM*HSGDSIRT 3    
18501002KVDEFVTGNLSFDQINQAFDLMHSGDSIRT 3    
18501002RDPEGCFPVILGHEGAGIVESVGEGVTKLKA 3    
16948836VDEFVTHNLSFDEINK0.8 (delta mass [ppm])3    
16684767KAAVAWEAGKPLSIEEIEVAPPKAHEVRI 3    
16684767KAGDTVIPLYIPQCGECKF 2    
16684767KLKAGDTVIPLYIPQCGECKF 2    
18614015(K)VCLLGCGISTGYGAAVNTAK(V)      peptide count: 1
18614015(R)SALEAAHK(G)      peptide count: 4
21616181AGDTVIPLYIPQCGECK2187.05693 (observed)   N-Term(iTRAQ4plex), C13(Methylthio), C16(Methylthio), K17(iTRAQ4plex)peptide count: 3
21616181AGDTVIPLYIPQCGECK2187.06131 (observed)   N-Term(iTRAQ4plex), C13(Methylthio), C16(Methylthio), K17(iTRAQ4plex)peptide count: 2
21616181EFGASECISPQDFSK1978.91509 (observed)   N-Term(iTRAQ4plex), C7(Methylthio), K15(iTRAQ4plex)peptide count: 4
21616181EFGASECISPQDFSK1978.91709 (observed)   N-Term(iTRAQ4plex), C7(Methylthio), K15(iTRAQ4plex)XCorr (Sequest): 3.8peptide count: 1
21616181IIGIDINK1173.73821 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 3
21616181IIGIDINK1173.73821 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 3
21616181QFGASECISPQDFSK1978.91509 (observed)   N-Term(iTRAQ4plex), Q1(Deamidated), C7(Methylthio), K15(iTRAQ4plex)peptide count: 4
21616181QFGASECISPQDFSK1978.91709 (observed)   N-Term(iTRAQ4plex), Q1(Deamidated), C7(Methylthio), K15(iTRAQ4plex)XCorr (Sequest): 3.8peptide count: 1
21127740IDPLAPLDK491.29 (observed)22.41E+0628.85 (HPLC [min or %B]) MS2 score: 21.62
21127740IDPLAPLDK491.29 (observed)21.75E+0628.17 (HPLC [min or %B]) MS2 score: 25.95
21127740IDPLAPLDK491.28 (observed)21.27E+0728.56 (HPLC [min or %B]) MS2 score: 23.16
21127740IDPLAPLDK491.28 (observed)22.01E+0628.21 (HPLC [min or %B]) MS2 score: 33.78
21127740AGDTVIPLYIPQCGECK960.96 (observed)28.86E+0531.48 (HPLC [min or %B]) MS2 score: 29.87
21127740GTAFGGWK412.21 (observed)23.06E+0627.15 (HPLC [min or %B]) MS2 score: 33.58
21127740GTAFGGWK412.21 (observed)21.71E+0527.51 (HPLC [min or %B]) MS2 score: 32.15
21127740GTAFGGWK412.21 (observed)21.07E+0626.98 (HPLC [min or %B]) MS2 score: 22.95
21127740IDPLAPLDK491.29 (observed)21.20E+0623.72 (HPLC [min or %B]) MS2 score: 24.38
21127740IIGVDINKDK557.83 (observed)22.54E+0518.12 (HPLC [min or %B]) MS2 score: 30.87
UNPUBLISHED_1K.VMRAALEACHK.G    MS2 score: 3   
21127740LVSEYMSK478.74 (observed)21.66E+0617.62 (HPLC [min or %B]) MS2 score: 31.24
UNPUBLISHED_1R.VTQGK.G    MS2 score: 30   
21127740VDEFVTHNLSFDEINK636.31 (observed)32.61E+0628.99 (HPLC [min or %B]) MS2 score: 50.32
21127740VDEFVTHNLSFDEINK636.31 (observed)33.73E+0629.09 (HPLC [min or %B]) MS2 score: 58.95
21127740VDEFVTHNLSFDEINK636.31 (observed)34.79E+0525.57 (HPLC [min or %B]) MS2 score: 31.47
23376485AGDTVIPLYIPQCGECK960.966 (observed)   :::::::::::::Cys_CAM:::Cys_CAM::
23376485AGDTVIPLYIPQCGECK960.967 (observed)   :::::::::::::Cys_CAM:::Cys_CAM::
23376485AGDTVIPLYIPQCGECK960.966 (observed)   :::::::::::::Cys_CAM:::Cys_CAM::
23376485AGDTVIPLYIPQCGECK960.966 (observed)   :::::::::::::Cys_CAM:::Cys_CAM::
23376485IIGVDINKDK557.831 (observed)   :::::::::::
23376485IIGVDINKDK557.828 (observed)   :::::::::::
23376485IKVDEFVTHNLSFDEINK716.707 (observed)   :::::::::::::::::::
23376485VCLLGCGISTGYGAAVNTAK1006.507 (observed)   ::Cys_CAM::::Cys_CAM:::::::::::::::
23376485VDEFVTHNLSFDEINK953.969 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK636.315 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK636.316 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK953.964 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK953.966 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK636.312 (observed)   :::::::::::::::::
23376485VDEFVTHNLSFDEINK636.313 (observed)   :::::::::::::::::

Compile date 12-23-2014© PADB initiative