PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5708ADA, ADA1Adenosine deaminase

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)ANYSLNTDDPLIFK(S)      peptide count: 1
18614015(K)VDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIK(V)      peptide count: 2
18614015(R)EAVDILK(T)      peptide count: 1
18614015(R)GIALPADTVEELRNIIGMDKPLSLPGFLAK(F)      peptide count: 2
18614015(R)IAYEFVEMK(A)      peptide count: 1
18614015(R)LNINAAK(S)      peptide count: 2
18614015(R)NIIGMDKPLSLPGFLAK(F)      peptide count: 1
18614015(R)VGHGYHTIEDEALYNR(L)      peptide count: 2
18614015(R)YSPHLLANSK(V)      peptide count: 1

Compile date 12-23-2014© PADB initiative