PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5703ACY1, ABHD14A-ACY1Aminoacylase-1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836AFEEQLQSWCQAAGEGVTLEFAQK0.8 (delta mass [ppm])3    
16948836AGFALDEGIANPTDAFTVFYSER0.3 (delta mass [ppm])2    
16948836AGFALDEGIANPTDAFTVFYSER2 (delta mass [ppm])2    
16948836AVGVPALGFSPMNR0 (delta mass [ppm])2    
16948836AVGVPALGFSPMNR2.4 (delta mass [ppm])2    
16948836AVGVPALGFSPMNR2.4 (delta mass [ppm])2    
16948836CVSIQYLEAVR0.4 (delta mass [ppm])2    
16948836CVSIQYLEAVR2.7 (delta mass [ppm])2    
16948836CVSIQYLEAVR2.3 (delta mass [ppm])2    
16948836DMNLTLEPEIMPAATDNR0.2 (delta mass [ppm])2    
16948836DMNLTLEPEIMPAATDNR4.8 (delta mass [ppm])2    
16948836DSEGYIYAR1.1 (delta mass [ppm])2    
16948836DSEGYIYAR0.4 (delta mass [ppm])2    
16948836DSEGYIYAR2.1 (delta mass [ppm])2    
16948836EGSVTSVNLTK1.8 (delta mass [ppm])2    
16948836EGSVTSVNLTK1.1 (delta mass [ppm])2    
16948836EHWSHDPFEAFK3.9 (delta mass [ppm])2    
16948836FMEDTAAEK0.8 (delta mass [ppm])2    
16948836FMEDTAAEK0.3 (delta mass [ppm])2    
16948836FMEDTAAEK2.3 (delta mass [ppm])2    
16948836GPEEEHPSVTLFR1 (delta mass [ppm])2    
16948836GPEEEHPSVTLFR1.4 (delta mass [ppm])2    
16948836GPEEEHPSVTLFR0.5 (delta mass [ppm])2    
16316981GPEEEHPSVTLFR      peptide count: 1
16948836GVDIYTR0 (delta mass [ppm])2    
16948836GVDIYTR1.1 (delta mass [ppm])2    
16948836LEGGVAYNVIPATMSASFDFR1.7 (delta mass [ppm])2    
16948836LEGGVAYNVIPATMSASFDFR3.6 (delta mass [ppm])2    
16948836LHEAVFLR1.3 (delta mass [ppm])2    
16948836LHEAVFLR2.3 (delta mass [ppm])2    
16948836LKVEGHR0.7 (delta mass [ppm])2    
16948836LLPALASVPALPSDS1 (delta mass [ppm])2    
16316981LLPALASVPALPSDS      peptide count: 3
16948836LQSNPHLK0.1 (delta mass [ppm])2    
16948836LQSNPHLK1.6 (delta mass [ppm])2    
16948836LQSNPHLK2 (delta mass [ppm])2    
16948836PDYGAAVAFFEETAR1.2 (delta mass [ppm])2    
16948836TPVLLHDHDER0.2 (delta mass [ppm])3    
16948836TPVLLHDHDER1.1 (delta mass [ppm])3    
16948836TPVLLHDHDER2 (delta mass [ppm])2    
16948836TVQPKPDYGAAVAFFEETAR0.6 (delta mass [ppm])3    
16948836TVQPKPDYGAAVAFFEETAR4.9 (delta mass [ppm])2    
16316981TVQPKPDYGAAVAFFEETAR      peptide count: 1
16948836VAPDVDFK0.4 (delta mass [ppm])1    
16948836VAPDVDFK1.2 (delta mass [ppm])2    
16948836VAPDVDFK2.7 (delta mass [ppm])2    
16948836VEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFK4.3 (delta mass [ppm])3    
16948836VTSTGRPGHASR0.7 (delta mass [ppm])3    
16948836VVNSILAFR1.3 (delta mass [ppm])2    
16948836VVNSILAFR0.2 (delta mass [ppm])2    
16948836VVNSILAFR2.6 (delta mass [ppm])2    
16948836WMHPQVTPTDDSNPWWAAFSR0.1 (delta mass [ppm])3    
16948836WMHPQVTPTDDSNPWWAAFSR0.4 (delta mass [ppm])3    
16684767KAFEEQLQSWCQAAGEGVTLEFAQKW 3    
16684767KCVSIQYLEAVRR 2    
16684767KCVSIQYLEAVRRL 2    
16684767KDM*NLTLEPEIM*PAATDNRY 2    
16684767KDM*NLTLEPEIMPAATDNRY 2    
16684767KDMNLTLEPEIMPAATDNRY 2    
16684767KEHWSHDPFEAFKDSEGYIYARG 3    
16684767KGPEEEHPSVTLFRQ 2    
16684767KLEGGVAYNVIPATMSASFDFRV 2    
16684767KVVNSILAFRE 2    
16684767KWMHPQVTPTDDSNPWWAAFSRV 3    
16684767RAGFALDEGIANPTDAFTVFYSERS 2    
16684767RFMEDTAAEKLHKV 2    
16684767RLHEAVFLRG 1    
16684767RLLPALASVPALPSDS- 2    
16684767RTPVLLHDHDERL 2    
16684767RTVQPKPDYGAAVAFFEETARQ 2    
16684767RVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKW 3    
16684767RVCKDMNLTLEPEIMPAATDNRY 3    
18361515K.AFEEQLQSWCQAAGEGVTLEFAQK.W1364.18 (observed)2    
18361515R.AGFALDEGIANPTDAFTVFYSER.S1246.95 (observed)2    
18614015(K)SVSIQYLEAVRR(L)      peptide count: 1
18614015(K)VISSILAFR(E)      peptide count: 1
18614015(R)ARQLGLSCQK(I)      peptide count: 1
18614015(R)FIEDTAAEKLHK(V)      peptide count: 1
21127740VVNSILAFR509.81 (observed)23.93E+0625.09 (HPLC [min or %B]) MS2 score: 62.44
21127740VVNSILAFR509.81 (observed)21.41E+0624.76 (HPLC [min or %B]) MS2 score: 37.18
21127740VVNSILAFR509.81 (observed)21.88E+0624.96 (HPLC [min or %B]) MS2 score: 50.05
21127740VVNSILAFR509.81 (observed)21.80E+0625.12 (HPLC [min or %B]) MS2 score: 46.7
21127740VVNSILAFR509.81 (observed)23.94E+0624.99 (HPLC [min or %B]) MS2 score: 36.62
21127740VVNSILAFR509.81 (observed)21.24E+0625.1 (HPLC [min or %B]) MS2 score: 42.6
21127740AVGVPALGFSPMNR716.37 (observed)22.66E+0628.24 (HPLC [min or %B])Oxidation (M)MS2 score: 31.36
21127740CVSIQYLEAVR669.35 (observed)22.22E+0629.55 (HPLC [min or %B]) MS2 score: 58.77
21127740CVSIQYLEAVR669.35 (observed)26.69E+0529.84 (HPLC [min or %B]) MS2 score: 70.19
21127740CVSIQYLEAVR669.35 (observed)21.17E+0629.74 (HPLC [min or %B]) MS2 score: 58.37
21127740CVSIQYLEAVR669.35 (observed)22.50E+0629.67 (HPLC [min or %B]) MS2 score: 70.59
21127740CVSIQYLEAVR669.35 (observed)26.81E+0529.66 (HPLC [min or %B]) MS2 score: 56.97
21127740CVSIQYLEAVR669.35 (observed)21.17E+0629.69 (HPLC [min or %B]) MS2 score: 57.79
21127740CVSIQYLEAVR669.35 (observed)21.04E+0629.8 (HPLC [min or %B]) MS2 score: 70.88
21127740CVSIQYLEAVR669.35 (observed)22.51E+0625.74 (HPLC [min or %B]) MS2 score: 68.93
21127740CVSIQYLEAVR669.35 (observed)22.64E+0625.88 (HPLC [min or %B]) MS2 score: 63.76
21127740CVSIQYLEAVR669.35 (observed)21.40E+0625.93 (HPLC [min or %B]) MS2 score: 59.12
21127740CVSIQYLEAVR669.35 (observed)23.22E+0526.07 (HPLC [min or %B]) MS2 score: 38.15
21127740CVSIQYLEAVR669.35 (observed)22.78E+0626.21 (HPLC [min or %B]) MS2 score: 68.08
21127740CVSIQYLEAVR669.35 (observed)22.68E+0626.1 (HPLC [min or %B]) MS2 score: 56.68
21127740CVSIQYLEAVR669.35 (observed)28.83E+0525.97 (HPLC [min or %B]) MS2 score: 62.61
21127740CVSIQYLEAVR669.35 (observed)29.83E+0533.86 (HPLC [min or %B]) MS2 score: 46.64
21127740CVSIQYLEAVR669.35 (observed)22.50E+0634.06 (HPLC [min or %B]) MS2 score: 70.5
21127740CVSIQYLEAVR669.35 (observed)21.60E+0529.86 (HPLC [min or %B]) MS2 score: 61.09
21127740CVSIQYLEAVR669.35 (observed)27.52E+0525.89 (HPLC [min or %B]) MS2 score: 41.63
21127740CVSIQYLEAVR669.35 (observed)21.83E+0630.24 (HPLC [min or %B]) MS2 score: 63.64
21127740GPEEEHPSVTLFR499.92 (observed)32.48E+0623.45 (HPLC [min or %B]) MS2 score: 54.09
21127740GPEEEHPSVTLFR499.92 (observed)39.35E+0524.1 (HPLC [min or %B]) MS2 score: 27.15
21127740GPEEEHPSVTLFR499.92 (observed)37.39E+0524.09 (HPLC [min or %B]) MS2 score: 38.29
21127740GPEEEHPSVTLFR499.92 (observed)32.71E+0623.7 (HPLC [min or %B]) MS2 score: 31.88
21127740GPEEEHPSVTLFR749.37 (observed)24.21E+0623.81 (HPLC [min or %B]) MS2 score: 54.2
21127740GPEEEHPSVTLFR499.92 (observed)31.00E+0623.81 (HPLC [min or %B]) MS2 score: 31.97
21127740GPEEEHPSVTLFR499.92 (observed)31.29E+0624.03 (HPLC [min or %B]) MS2 score: 40.43
21127740GPEEEHPSVTLFR749.37 (observed)22.16E+0624.17 (HPLC [min or %B]) MS2 score: 61.45
21127740GPEEEHPSVTLFR499.92 (observed)35.54E+0524.84 (HPLC [min or %B]) MS2 score: 34.12
21127740GPEEEHPSVTLFR749.37 (observed)25.80E+0522.77 (HPLC [min or %B]) MS2 score: 37.75
21127740GPEEEHPSVTLFR499.92 (observed)33.71E+0623.2 (HPLC [min or %B]) MS2 score: 41.98
21127740GPEEEHPSVTLFR749.37 (observed)29.07E+0623.77 (HPLC [min or %B]) MS2 score: 55.78
21127740GPEEEHPSVTLFR499.92 (observed)31.27E+0623.37 (HPLC [min or %B]) MS2 score: 39.18
21127740GPEEEHPSVTLFR749.37 (observed)22.47E+0623.59 (HPLC [min or %B]) MS2 score: 52.3
21127740GPEEEHPSVTLFR499.92 (observed)37.27E+0523.27 (HPLC [min or %B]) MS2 score: 32.79
21127740LLPALASVPALPSDS725.91 (observed)24.62E+0533.49 (HPLC [min or %B]) MS2 score: 29.43
21127740LLPALASVPALPSDS725.91 (observed)26.03E+0533.55 (HPLC [min or %B]) MS2 score: 26.61
21127740SPWWVR415.72 (observed)23.88E+0528.94 (HPLC [min or %B]) MS2 score: 27.12
21127740SPWWVR415.72 (observed)27.24E+0529.04 (HPLC [min or %B]) MS2 score: 19.48
21127740SPWWVR415.72 (observed)23.60E+0628.55 (HPLC [min or %B]) MS2 score: 29.81
21127740SPWWVR415.72 (observed)24.88E+0528.59 (HPLC [min or %B]) MS2 score: 26.7
21127740SPWWVR415.72 (observed)21.40E+0628.87 (HPLC [min or %B]) MS2 score: 26.72
21127740SPWWVR415.72 (observed)23.83E+0528.61 (HPLC [min or %B]) MS2 score: 22.67
21127740SPWWVR415.72 (observed)24.64E+0624.5 (HPLC [min or %B]) MS2 score: 21.95
21127740SPWWVR415.72 (observed)22.05E+0625.84 (HPLC [min or %B]) MS2 score: 29.1
21127740SPWWVR415.72 (observed)21.54E+0633.02 (HPLC [min or %B]) MS2 score: 28.69
21127740SPWWVR415.72 (observed)22.51E+0633.04 (HPLC [min or %B]) MS2 score: 28.95
21127740SPWWVR415.72 (observed)24.56E+0528.18 (HPLC [min or %B]) MS2 score: 23.64
21127740SPWWVR415.72 (observed)24.85E+0527.88 (HPLC [min or %B]) MS2 score: 22.92
21127740SPWWVR415.72 (observed)22.13E+0628.23 (HPLC [min or %B]) MS2 score: 30.51
21127740TVQPKPDYGAAVAFFEETAR733.37 (observed)32.68E+0635.85 (HPLC [min or %B])Deamidation (NQ)MS2 score: 74.57
21127740TVQPKPDYGAAVAFFEETAR733.37 (observed)31.91E+0635.75 (HPLC [min or %B])Deamidation (NQ)MS2 score: 64.25
21127740TVQPKPDYGAAVAFFEETAR733.37 (observed)33.33E+0635.56 (HPLC [min or %B])Deamidation (NQ)MS2 score: 42.99
21127740VVNSILAFR509.81 (observed)21.44E+0525.6 (HPLC [min or %B]) MS2 score: 25.75
21127740VVNSILAFR509.81 (observed)22.68E+0525.47 (HPLC [min or %B]) MS2 score: 41.4
21127740VVNSILAFR509.81 (observed)21.96E+0525.1 (HPLC [min or %B]) MS2 score: 27.08
21127740VVNSILAFR509.81 (observed)28.62E+0525.23 (HPLC [min or %B]) MS2 score: 40.36
21127740VVNSILAFR509.81 (observed)25.25E+0530.29 (HPLC [min or %B]) MS2 score: 44.84
21127740VVNSILAFR509.81 (observed)26.19E+0529.99 (HPLC [min or %B]) MS2 score: 71.78
21127740VVNSILAFR509.81 (observed)27.10E+0530.07 (HPLC [min or %B]) MS2 score: 67.6
21127740VVNSILAFR509.81 (observed)27.32E+0530.13 (HPLC [min or %B]) MS2 score: 31.05
21127740VVNSILAFR509.81 (observed)28.16E+0529.79 (HPLC [min or %B]) MS2 score: 57.76
21127740VVNSILAFR509.8 (observed)21.68E+0525.29 (HPLC [min or %B]) MS2 score: 44.82
21127740VVNSILAFR509.81 (observed)28.09E+0524.04 (HPLC [min or %B]) MS2 score: 20.52
21127740VVNSILAFR509.81 (observed)21.01E+0624.85 (HPLC [min or %B]) MS2 score: 25.1
21127740VVNSILAFR509.81 (observed)22.83E+0525.18 (HPLC [min or %B]) MS2 score: 26.7
21127740VVNSILAFR509.81 (observed)25.97E+0525.44 (HPLC [min or %B]) MS2 score: 35.31
21127740VVNSILAFR509.81 (observed)24.59E+0525.59 (HPLC [min or %B]) MS2 score: 25.46
21127740VVNSILAFR509.81 (observed)29.73E+0526.2 (HPLC [min or %B]) MS2 score: 27.24
21127740VVNSILAFR509.8 (observed)24.14E+0525.22 (HPLC [min or %B]) MS2 score: 21.99
21127740VVNSILAFR509.81 (observed)22.60E+0525.05 (HPLC [min or %B]) MS2 score: 21.27
21127740VVNSILAFR509.81 (observed)24.91E+0525.06 (HPLC [min or %B]) MS2 score: 34.28
21127740VVNSILAFR509.8 (observed)27.94E+0534.03 (HPLC [min or %B]) MS2 score: 53.11
21127740VVNSILAFR509.81 (observed)25.90E+0634.31 (HPLC [min or %B]) MS2 score: 46.81
21127740AGFALDEGIANPTDAFTVFYSER1246.09 (observed)22.79E+0639.01 (HPLC [min or %B]) MS2 score: 77.76
21127740AVGVPALGFSPMNR716.38 (observed)21.67E+0628.32 (HPLC [min or %B])Oxidation (M)MS2 score: 29.67
21127740AVGVPALGFSPMNR716.38 (observed)27.02E+0628.22 (HPLC [min or %B])Oxidation (M)MS2 score: 38.46
21127740AVGVPALGFSPMNR716.37 (observed)25.10E+0628.53 (HPLC [min or %B])Oxidation (M)MS2 score: 31.2
21127740AVGVPALGFSPMNR716.37 (observed)21.06E+0625.54 (HPLC [min or %B])Oxidation (M)MS2 score: 30.06
21127740CVSIQYLEAVR669.35 (observed)22.04E+0629.98 (HPLC [min or %B]) MS2 score: 53.29
21127740CVSIQYLEAVR669.34 (observed)22.58E+0629.94 (HPLC [min or %B]) MS2 score: 41.01
21127740CVSIQYLEAVR669.35 (observed)21.78E+0629.56 (HPLC [min or %B]) MS2 score: 57.44
21127740CVSIQYLEAVR669.35 (observed)21.91E+0625.67 (HPLC [min or %B]) MS2 score: 32.75
21127740DSEGYIYAR537.25 (observed)21.98E+0622.35 (HPLC [min or %B]) MS2 score: 38.33
21127740EGSVTSVNLTK567.8 (observed)27.58E+0517.34 (HPLC [min or %B]) MS2 score: 36.2
21127740FMEDTAAEK529.23 (observed)21.12E+067.44 (HPLC [min or %B])Oxidation (M)MS2 score: 36.46
21127740FMEDTAAEK529.23 (observed)26.81E+0413.57 (HPLC [min or %B])Oxidation (M)MS2 score: 24.91
21127740FMEDTAAEK529.23 (observed)26.56E+0510.78 (HPLC [min or %B])Oxidation (M)MS2 score: 31.69
21127740GPEEEHPSVTLFR499.92 (observed)31.62E+0621.12 (HPLC [min or %B]) MS2 score: 41.09
21127740GPEEEHPSVTLFR499.92 (observed)31.56E+0623.68 (HPLC [min or %B]) MS2 score: 27.55
21127740GPEEEHPSVTLFR499.92 (observed)34.54E+0627.65 (HPLC [min or %B]) MS2 score: 32.47
21127740GPEEEHPSVTLFR499.92 (observed)37.07E+0523.38 (HPLC [min or %B]) MS2 score: 33.95
21127740GPEEEHPSVTLFR749.37 (observed)22.31E+0523.28 (HPLC [min or %B]) MS2 score: 31.96
21127740GVDIYTR412.22 (observed)28.44E+0521.12 (HPLC [min or %B]) MS2 score: 27.05
21127740LHEAVFLR492.78 (observed)24.43E+0621.84 (HPLC [min or %B]) MS2 score: 27.25
21127740LHEAVFLR492.78 (observed)22.31E+0621.02 (HPLC [min or %B]) MS2 score: 33.14
21127740LLPALASVPALPSDS725.91 (observed)23.11E+0636.84 (HPLC [min or %B]) MS2 score: 28.15
21127740LLPALASVPALPSDS725.91 (observed)21.42E+0636.96 (HPLC [min or %B]) MS2 score: 31.61
21127740LLPALASVPALPSDS725.91 (observed)23.69E+0633.08 (HPLC [min or %B]) MS2 score: 34.42
21127740LQSNPHLK468.77 (observed)21.27E+056.29 (HPLC [min or %B]) MS2 score: 24.94
21127740QLGLGCQK452.24 (observed)22.26E+0611.46 (HPLC [min or %B]) MS2 score: 43.05
21127740QLGLGCQK452.24 (observed)29.62E+0518.59 (HPLC [min or %B]) MS2 score: 22.13
21127740SPWWVR415.72 (observed)27.79E+0622.81 (HPLC [min or %B]) MS2 score: 29.42
21127740SPWWVR415.72 (observed)21.86E+0628.39 (HPLC [min or %B]) MS2 score: 30.45
21127740TPVLLHDHDER444.56 (observed)32.80E+0610.74 (HPLC [min or %B]) MS2 score: 34.31
21127740TPVLLHDHDER444.56 (observed)34.36E+0616.02 (HPLC [min or %B]) MS2 score: 39.41
21127740TVQPKPDYGAAVAFFEETAR733.04 (observed)31.25E+0631.69 (HPLC [min or %B]) MS2 score: 27.68
21127740TVQPKPDYGAAVAFFEETAR733.04 (observed)35.49E+0532.7 (HPLC [min or %B]) MS2 score: 29.84
21127740TVQPKPDYGAAVAFFEETAR733.04 (observed)31.80E+0635.27 (HPLC [min or %B]) MS2 score: 57.73
21127740TVQPKPDYGAAVAFFEETAR733.04 (observed)32.04E+0531.94 (HPLC [min or %B]) MS2 score: 34.29
21127740VVNSILAFR509.81 (observed)23.85E+0529.47 (HPLC [min or %B]) MS2 score: 31.94
21127740VVNSILAFR509.81 (observed)23.74E+0529.6 (HPLC [min or %B]) MS2 score: 32.5
21127740VVNSILAFR509.81 (observed)22.46E+0630.1 (HPLC [min or %B]) MS2 score: 31.44
21127740VVNSILAFR509.81 (observed)22.60E+0630.16 (HPLC [min or %B]) MS2 score: 33.4
21127740VVNSILAFR509.8 (observed)21.44E+0634.08 (HPLC [min or %B]) MS2 score: 25.08
23376485AGFALDEGIANPTDAFTVFYSER831.066 (observed)   ::::::::::::::::::::::::
23376485AGFALDEGIANPTDAFTVFYSER1246.097 (observed)   ::::::::::::::::::::::::
23376485AGFALDEGIANPTDAFTVFYSER1246.099 (observed)   ::::::::::::::::::::::::
23376485AVGVPALGFSPMNR716.377 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.377 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.376 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.375 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.379 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.38 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR716.377 (observed)   ::::::::::::Oxidation_M:::
23376485AVGVPALGFSPMNR708.386 (observed)   :::::::::::::::
23376485CVSIQYLEAVR669.348 (observed)   :Cys_CAM:::::::::::
23376485CVSIQYLEAVR669.35 (observed)   :Cys_CAM:::::::::::
23376485DMNLTLEPEIMPAATDNR1015.983 (observed)   :::::::::::::::::::
23376485DMNLTLEPEIMPAATDNR1023.98 (observed)   :::::::::::Oxidation_M::::::::
23376485DMNLTLEPEIMPAATDNR1023.98 (observed)   :::::::::::Oxidation_M::::::::
23376485DMNLTLEPEIMPAATDNR1023.981 (observed)   :::::::::::Oxidation_M::::::::
23376485DMNLTLEPEIMPAATDNR1023.977 (observed)   :::::::::::Oxidation_M::::::::
23376485DMNLTLEPEIMPAATDNR1023.976 (observed)   ::Oxidation_M:::::::::::::::::
23376485DMNLTLEPEIMPAATDNR1015.983 (observed)   :::::::::::::::::::
23376485DMNLTLEPEIMPAATDNR688.323 (observed)   ::Oxidation_M:::::::::Oxidation_M::::::::
23376485DMNLTLEPEIMPAATDNR682.988 (observed)   ::Oxidation_M:::::::::::::::::
23376485EHWSHDPFEAFK765.347 (observed)   :::::::::::::
23376485EHWSHDPFEAFK510.566 (observed)   :::::::::::::
23376485EHWSHDPFEAFK765.345 (observed)   :::::::::::::
23376485EHWSHDPFEAFK765.344 (observed)   :::::::::::::
23376485EHWSHDPFEAFKDSEGYIYAR646.796 (observed)   ::::::::::::::::::::::
23376485EHWSHDPFEAFKDSEGYIYAR862.058 (observed)   ::::::::::::::::::::::
23376485EHWSHDPFEAFKDSEGYIYAR862.058 (observed)   ::::::::::::::::::::::
23376485EHWSHDPFEAFKDSEGYIYAR646.796 (observed)   ::::::::::::::::::::::
23376485GPEEEHPSVTLFR749.369 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.372 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.373 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.918 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.372 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.919 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.917 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.374 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.918 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.918 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.376 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.918 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR749.374 (observed)   ::::::::::::::
23376485GPEEEHPSVTLFR499.919 (observed)   ::::::::::::::
23376485LEGGVAYNVIPATMSASFDFR1131.051 (observed)   ::::::::::::::Oxidation_M::::::::
23376485LEGGVAYNVIPATMSASFDFR754.369 (observed)   ::::::::::::::Oxidation_M::::::::
23376485LHEAVFLR492.786 (observed)   :::::::::
23376485LLPALASVPALPSDS725.916 (observed)   ::::::::::::::::
23376485LLPALASVPALPSDS725.914 (observed)   ::::::::::::::::
23376485LLPALASVPALPSDS725.915 (observed)   ::::::::::::::::
23376485LLPALASVPALPSDS725.915 (observed)   ::::::::::::::::
23376485PDYGAAVAFFEETAR822.392 (observed)   ::::::::::::::::
23376485PDYGAAVAFFEETAR548.598 (observed)   ::::::::::::::::
23376485PDYGAAVAFFEETAR822.389 (observed)   ::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.039 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR1099.055 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.04 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR1099.057 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.039 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR1099.054 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.04 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.037 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.039 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.04 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.039 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.042 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.04 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.038 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.041 (observed)   :::::::::::::::::::::
23376485TVQPKPDYGAAVAFFEETAR733.041 (observed)   :::::::::::::::::::::
23376485VAPDVDFK445.735 (observed)   :::::::::
23376485VAPDVDFK445.735 (observed)   :::::::::
23376485VCKDMNLTLEPEIMPAATDNR817.385 (observed)   ::Cys_CAM:::Oxidation_M:::::::::Oxidation_M::::::::
23376485VCKDMNLTLEPEIMPAATDNR812.056 (observed)   ::Cys_CAM:::Oxidation_M:::::::::::::::::
23376485VCKDMNLTLEPEIMPAATDNR817.384 (observed)   ::Cys_CAM:::Oxidation_M:::::::::Oxidation_M::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.806 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.805 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.806 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.807 (observed)   ::::::::::
23376485VVNSILAFR509.808 (observed)   ::::::::::
23376485WMHPQVTPTDDSNPWWAAFSR849.054 (observed)   ::Oxidation_M::::::::::::::::::::
23376485WMHPQVTPTDDSNPWWAAFSR849.052 (observed)   ::Oxidation_M::::::::::::::::::::
23376485WMHPQVTPTDDSNPWWAAFSR849.053 (observed)   ::Oxidation_M::::::::::::::::::::
23376485WMHPQVTPTDDSNPWWAAFSR843.716 (observed)   ::::::::::::::::::::::
23376485WMHPQVTPTDDSNPWWAAFSR849.052 (observed)   ::Oxidation_M::::::::::::::::::::

Compile date 12-23-2014© PADB initiative