PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5697ACSM1, BUCS1, LAEAcyl-coenzyme A synthetase ACSM1, mitochondrial

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AFIVLNPEFLSHDQEQLIK(E)      peptide count: 8
18614015(K)AILPFDLQIIDEK(G)      peptide count: 5
18614015(K)AILPFDLQIIDEKGNILPPNTEGYIGIR(I)      peptide count: 1
18614015(K)AKDILYR(I)      peptide count: 9
18614015(K)ELQHHVK(S)      peptide count: 7
18614015(K)HNQGLAFR(S)      peptide count: 6
18614015(K)MKDPMAIFFTSGTTGYPK(M)      peptide count: 2
18614015(K)MVLQQK(S)      peptide count: 4
18614015(K)RGPSPAFWWVNGQGDEIK(W)      peptide count: 4
18614015(K)SASPDHTCIK(S)      peptide count: 16
18614015(K)SVTAPYK(Y)      peptide count: 15
18614015(K)SVTAPYKYPR(K)      peptide count: 32
18614015(K)VIVEVLFK(Y)      peptide count: 4
18614015(K)YPITQCLAAPGVYR(M)      peptide count: 2
18614015(R)ATIDEEGYIWFLGR(G)      peptide count: 10
18614015(R)FPTLEHCTTGGESLLPEEYEQWK(Q)      peptide count: 2
18614015(R)GDDVINASGYR(I)      peptide count: 15
18614015(R)GPSPAFWWVNGQGDEIK(W)      peptide count: 2
18614015(R)IKPTRPLGLFMEYENSPESTSEVECGDFYNSGDR(A)      peptide count: 1
18614015(R)KVEFVSELPK(T)      peptide count: 8
18614015(R)NKEFGQL(-)      peptide count: 2
18614015(R)SYIPSCR(K)      peptide count: 1
18614015(R)TGIIFMPGTTQLK(A)      peptide count: 5
18614015(R)TGLSIHEVYGQSETGISSATLR(E)      peptide count: 4
18614015(R)WNDHDSPEEFNFASDVLDYWAQMEEEGK(R)      peptide count: 3
18614015(R)WNDHDSPEEFNFASDVLDYWAQMEEEGKR(G)      peptide count: 1
21616181AIVTTASLVPEVESVASECPDLK2692.41245 (observed)   N-Term(iTRAQ4plex), C19(Methylthio), K23(iTRAQ4plex)peptide count: 3
21616181GDDVINASGYR1310.64739 (observed)   N-Term(iTRAQ4plex)MS2 score: 57peptide count: 1
21616181GNILPPNTEGYIGIR1757.96648 (observed)   N-Term(iTRAQ4plex) peptide count: 1

Compile date 12-23-2014© PADB initiative