PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5693ACSL1, FACL1, FACL2Long-chain-fatty-acid--CoA ligase 1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KDINKAILDDLLKLGKE 2    
18501002RTAEALDKDGWLHTGDIGKW 3    
18614015(-)MEVHELFR(Y)      peptide count: 1
18614015(K)AELSVIFADKPEK(A)      peptide count: 20
18614015(K)AKRPELR(E)      peptide count: 4
18614015(K)AKRPELR(N)      peptide count: 3
18614015(K)AKRPELRNYFR(S)      peptide count: 1
18614015(K)ALEDLGR(V)      peptide count: 33
18614015(K)ALEDLGRVNR(V)      peptide count: 1
18614015(K)ALKPPCDLSMQSVEIAGTTDGIR(R)      peptide count: 7
18614015(K)ALKPPCDLSMQSVEIAGTTDGIRR(S)      peptide count: 2
18614015(K)CGVEIISLK(A)      peptide count: 2
18614015(K)DGWLHTGDIGK(W)      peptide count: 7
18614015(K)EAELR(S)      peptide count: 1
18614015(K)EAGLKPFEQVK(G)      peptide count: 32
18614015(K)EVAELAECIGSGLIQK(G)      peptide count: 35
18614015(K)GAMITHQNIINDCSGFIK(A)      peptide count: 11
18614015(K)GANVFK(G)      peptide count: 15
18614015(K)GEGEVCVK(G)      peptide count: 25
18614015(K)GIAVHPELFSIDNGLLTPTLK(A)      peptide count: 68
18614015(K)GYLKDPAR(T)      peptide count: 30
18614015(K)IENIYIR(S)      peptide count: 24
18614015(K)IENIYLR(S)      peptide count: 1
18614015(K)IGFFQGDIR(L)      peptide count: 29
18614015(K)IIVIMDSYGSDLVER(G)      peptide count: 22
18614015(K)IQSSLGGK(V)      peptide count: 43
18614015(K)KCGVEIISLK(A)      peptide count: 2
18614015(K)KHIFK(L)      peptide count: 2
18614015(K)LAQGEYIAPEK(I)      peptide count: 31
18614015(K)LAQGEYIAPEKIENIYLR(S)      peptide count: 2
18614015(K)LLLEGVENK(L)      peptide count: 33
18614015(K)LLVYYYDDVR(T)      peptide count: 2
18614015(K)LVDVEEMNYLASK(G)      peptide count: 13
18614015(K)RGLQGSFEELCR(N)      peptide count: 3
18614015(K)RPELR(E)      peptide count: 38
18614015(K)RPELR(N)      peptide count: 6
18614015(K)VLQPTIFPVVPR(L)      peptide count: 48
18614015(K)VLQPTIFPVVPR(L)      peptide count: 2
18614015(R)GIQVSNNGPCLGSR(K)      peptide count: 19
18614015(R)GLQGSFEELCR(N)      peptide count: 25
18614015(R)IFGQANTSLK(R)      peptide count: 13
18614015(R)IFGQANTSLKR(W)      peptide count: 12
18614015(R)KEAELR(Q)      peptide count: 1
18614015(R)KPNQPYEWISYK(E)      peptide count: 19
18614015(R)LLMDDLK(V)      peptide count: 11
18614015(R)LLMDDLK(V)      peptide count: 1
18614015(R)LMITGAAPVSATVLTFLR(T)      peptide count: 42
18614015(R)MPELIDIR(Q)      peptide count: 12
18614015(R)NKDINK(A)      peptide count: 10
18614015(R)NNSLWDK(L)      peptide count: 6
18614015(R)NNSLWDKLIFHK(I)      peptide count: 1
18614015(R)NNSLWDKLIFHK(I)      peptide count: 2
18614015(R)NNSLWDKLIFHKIQSSLGGK(V)      peptide count: 2
18614015(R)SAVLEDDK(L)      peptide count: 10
18614015(R)SAVLEDDKLLVYYYDDVR(T)      peptide count: 11
18614015(R)SEAVAQVFVHGESLQAFLIAVVVPDVESLPSWAQK(R)      peptide count: 4
18614015(R)SQIDELYATIK(I)      peptide count: 13
18614015(R)SQIDELYATIKI(-)      peptide count: 9
18614015(R)TAEALDK(D)      peptide count: 4
18614015(R)TAEALDKDGWLHTGDIGK(W)      peptide count: 14
18614015(R)TLPTNTLMGFGAFAALTTFWYATRPK(A)      peptide count: 26
18614015(R)TMYDGFQR(G)      peptide count: 13
18614015(R)VKPKPPEPEDLAIICFTSGTTGNPK(G)      peptide count: 10
18614015(R)WLLDFASK(R)      peptide count: 34
15253431AILEDMVR 2   Pept_E (Sonar search): 8.00E-02 
15253431GFEGSFEELCR 2   Pept_E (Sonar search): 2.20E-03 
15253431GIQVSNNGPCLGSR 2   Pept_E (Sonar search): 6.40E-03 
15253431GPNVFKGYLK 2   Pept_E (Sonar search): 4.90E-03 
15253431GPNVFQGYLKDPAK 3   Pept_E (Sonar search): 2.50E-02 
15253431IGFFQGDIR 2   Pept_E (Sonar search): 1.40E-02 
15253431LAQGEYIAPEK 2   Pept_E (Sonar search): 9.90E-03 
15253431LLLEGVENK 2   Pept_E (Sonar search): 2.60E-01 
15253431NIVSDCSAFVK 2   Pept_E (Sonar search): 1.40E-01 
15253431QVAELSECIGSALIQK 3   Pept_E (Sonar search): 1.50E-04 
15253431SQIDDLYSTIK 2   Pept_E (Sonar search): 2.70E-03 
15253431VLQPTVFPVVPR 2   Pept_E (Sonar search): 1.20E-02 
21616181EVAELAECIGSGLIQK1994.05844 (observed)   N-Term(iTRAQ4plex), C8(Methylthio), K16(iTRAQ4plex)MS2 score: 41peptide count: 1
21616181EVAELAECIGSGLIQK1994.05643 (observed)   N-Term(iTRAQ4plex), C8(Methylthio), K16(iTRAQ4plex)peptide count: 6
21616181GIQVSNNGPCLGSR1592.76372 (observed)   N-Term(iTRAQ4plex), N7(Deamidated), C10(Methylthio)peptide count: 4
21616181GIQVSNNGPCLGSR1592.76592 (observed)   N-Term(iTRAQ4plex), N7(Deamidated), C10(Methylthio)peptide count: 6
21616181GLQGSFEELCR1428.67497 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 3
21616181GLQGSFEELCR1428.67473 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 4
21616181IGFFQGDIR1196.65911 (observed)   N-Term(iTRAQ4plex)MS2 score: 44peptide count: 1
21616181IGFFQGDIR1196.65618 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181IIVIMDSYGSDLVER1853.98185 (observed)   N-Term(iTRAQ4plex)MS2 score: 51peptide count: 1
21616181IIVIMDSYGSDLVER1853.98039 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181LLLEGVENK1302.79668 (observed)   N-Term(iTRAQ4plex), K9(iTRAQ4plex)peptide count: 2
21616181VLQPTIFPVVPR1509.9334 (observed)   N-Term(iTRAQ4plex)peptide count: 15
21616181VLQPTIFPVVPR1509.92876 (observed)   N-Term(iTRAQ4plex)peptide count: 15
21616181WLLDFASK1267.73699 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 3
21127740LAQGEYIAPEK610.31 (observed)22.92E+0517.45 (HPLC [min or %B])Deamidation (NQ)MS2 score: 33.6
21127740LAQGEYIAPEK609.82 (observed)28.94E+0520.46 (HPLC [min or %B]) MS2 score: 45.24
21127740VLQPTVFPVVPR676.41 (observed)22.29E+0631.87 (HPLC [min or %B]) MS2 score: 31.93
21127740VLQPTVFPVVPR676.41 (observed)29.02E+0527.73 (HPLC [min or %B]) MS2 score: 25.6
18563753FVDAYFR2    
18563753GIQVSNDGPCLGSR2    
18563753GIQVSNDGPCLGSR3    
18563753JPNQPYEWISYJ3    
18563753JPNQPYEWISYJ3    
18563753JPNQPYEWISYJ3    
18563753LVDVEDMNYQAAJ3    
18563753LVDVEDMNYQAAJ3    
18563753QVAEMAECIGSALIQJ3    
18563753TAEALDJDGWLHTGDIGJ4    
18563753TAEALDJDGWLHTGDIGJ4    
18563753TAEALDJDGWLHTGDIGJ4    
18563753TAEALDJDGWLHTGDIGJ4    
18563753TAEALDJDGWLHTGDIGJ4    
18563753WLLDFASJ2    
18563753WLLDFASJ2    
18563753WLLDFASJ2    
18563753WLLDFASJ2    

Compile date 12-23-2014© PADB initiative