PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5692AASDH, ACSF4, U26Acyl-CoA synthetase family member 4

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16684767LQQVESCAVTWYNQEKLILFMVSKDASVKE3303.7676 (observed)3   peptide count: 1

Compile date 12-23-2014© PADB initiative