PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5691ACSF3Acyl-CoA synthetase family member 3, mitochondrial

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)EGELLVR(G)      peptide count: 7
18614015(K)FLSSEAPQITVFMAVPTVYSK(L)      peptide count: 6
18614015(K)GSPYIIHAEGNER(G)      peptide count: 12
18614015(K)HFTQPHVQDFVR(A)      peptide count: 11
18614015(K)HPEAQLEYFIQDSR(S)      peptide count: 1
18614015(K)QLYPSGQR(S)      peptide count: 2
18614015(K)SAFTSDGWFR(T)      peptide count: 3
18614015(K)TSVDILK(I)      peptide count: 2
18614015(K)VGDLQEER(V)      peptide count: 8
18614015(K)VSALEIER(H)      peptide count: 8
18614015(K)VTPGFEEK(E)      peptide count: 4
18614015(K)VTPGFEEKEGELLVR(G)      peptide count: 3
18614015(K)YGHHTYR(E)      peptide count: 6
18614015(R)ALAFGDR(I)      peptide count: 9
18614015(R)EYWDKPEETK(S)      peptide count: 4
18614015(R)GAMIFYTSGTTGRPK(G)      peptide count: 2
18614015(R)GVLAPYAVPSELLLVEEIPR(N)      peptide count: 22
18614015(R)IALIDK(Y)      peptide count: 5
18614015(R)IISENPQK(G)      peptide count: 5
18614015(R)LGVPLLPLTPAVYHGATEKPTEQPVEESGWR(D)      peptide count: 2
18614015(R)LMVSGSAALPVPLLEK(W)      peptide count: 6
18614015(R)LSPLAQR(L)      peptide count: 2
18614015(R)NLAAVVTGLVHSWAWTK(N)      peptide count: 24
18614015(R)SATGHTLLER(Y)      peptide count: 23
18614015(R)SLCLAQEICR(L)      peptide count: 3
18614015(R)TGDTAVFK(D)      peptide count: 15
18614015(R)VPGSVGTPLPGVEVR(I)      peptide count: 15
18614015(R)VTAVVALQEGHSLSHGDLK(E)      peptide count: 8
18614015(R)YGMTEIGMALSNPLTEAR(V)      peptide count: 1
18614015(R)YWIR(G)      peptide count: 1
21616181EGELLVR959.56743 (observed)   N-Term(iTRAQ4plex) peptide count: 3

Compile date 12-23-2014© PADB initiative