PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5690ACSF2, UNQ493/PRO1009, UNQ493Acyl-CoA synthetase family member 2, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AASGLLSIGLR(K)      peptide count: 13
18614015(K)ALEAISR(E)      peptide count: 35
18614015(K)AQPGALK(S)      peptide count: 5
18614015(K)AQPGALKSER(L)      peptide count: 1
18614015(K)DMIIR(G)      peptide count: 2
18614015(K)EQNLAQLR(Y)      peptide count: 17
18614015(K)GATLSHHNIVNNSMLIGQR(L)      peptide count: 35
18614015(K)GATLSHHNIVNNSMLIGQR(L)      peptide count: 2
18614015(K)GIVFPK(Q)      peptide count: 14
18614015(K)GKISHFK(I)      peptide count: 1
18614015(K)GTLLYGTPTMFVDILNQPDFSSYDFTSIR(G)      peptide count: 19
18614015(K)HPQVQEAQVVGVK(D)      peptide count: 26
18614015(K)HPQVQEAQVVGVKDER(M)      peptide count: 63
18614015(K)ISHFK(I)      peptide count: 16
18614015(K)ISHFKIPR(Y)      peptide count: 1
18614015(K)KALEAISR(E)      peptide count: 6
18614015(K)LKMPTK(K)      peptide count: 20
18614015(K)LREQMEQHLK(L)      peptide count: 2
18614015(K)LREQMEQHLKL(-)      peptide count: 10
18614015(K)MPTKTAEELR(L)      peptide count: 1
18614015(K)QVCPELEK(A)      peptide count: 10
18614015(K)SERLPDLTTVISVDAPLPGTLLLDDIVAAGGK(E)      peptide count: 8
18614015(K)SGETTTAEEIK(A)      peptide count: 71
18614015(K)TAEELR(L)      peptide count: 23
18614015(K)TFETVGQDK(W)      peptide count: 43
18614015(K)TFETVGQDKWYR(T)      peptide count: 10
18614015(K)TQQYYDILK(Q)      peptide count: 21
18614015(R)AIINKMNMK(E)      peptide count: 1
18614015(R)EALVILHENIR(L)      peptide count: 26
18614015(R)EKGTLLYGTPTMFVDILNQPDFSSYDFTSIR(G)      peptide count: 8
18614015(R)EQMEQHLK(L)      peptide count: 5
18614015(R)EQMEQHLKL(-)      peptide count: 13
18614015(R)FLSCYDPINIQFTSGTTGNPK(G)      peptide count: 21
18614015(R)FPDREALVILHENIR(L)      peptide count: 3
18614015(R)GGENIYPAELEDFFLK(H)      peptide count: 91
18614015(R)GGENIYPAELEDFFLKHPQVQEAQVVGVK(D)      peptide count: 2
18614015(R)GGENIYPAELEDFFLKHPQVQEAQVVGVKDER(M)      peptide count: 2
18614015(R)GGVIAGSPAPPELIR(A)      peptide count: 42
18614015(R)GYCVMQGYWGEPQK(T)      peptide count: 4
18614015(R)IMPHTEAQIVNVETGELTNLNVPGELYIR(G)      peptide count: 22
18614015(R)LKSGETTTAEEIK(A)      peptide count: 15
18614015(R)LNFAQLK(E)      peptide count: 10
18614015(R)LNFAQLKEEVDK(A)      peptide count: 29
18614015(R)LNFAQLKEEVDKAASGLLSIGLR(K)      peptide count: 44
18614015(R)LNFAQLKEEVDKAASGLLSIGLRK(G)      peptide count: 1
18614015(R)LPDLTTVISVDAPLPGTLLLDDIVAAGGK(E)      peptide count: 29
18614015(R)LPDLTTVISVDAPLPGTLLLDDIVAAGGKEQNLAQLR(Y)      peptide count: 10
18614015(R)LVLPSPLYHCLGSVGGTMVSMMHGATLLLSSPSFNGK(K)      peptide count: 1
18614015(R)MGEEICACIR(L)      peptide count: 7
18614015(R)SKDMIIR(G)      peptide count: 46
18614015(R)TGDIALMDEQGFCK(I)      peptide count: 17
18614015(R)YIVFVEGYPLTISGK(I)      peptide count: 35
21616181GGVIAGSPAPPELIR1577.91265 (observed)   N-Term(iTRAQ4plex)peptide count: 6
21616181GGVIAGSPAPPELIR1577.91435 (observed)   N-Term(iTRAQ4plex)peptide count: 6
21127740AASGLLSIGLCK595.33 (observed)21.15E+0634.53 (HPLC [min or %B]) MS2 score: 48.09
21127740VQEVQVVGVK542.82 (observed)26.54E+0514.61 (HPLC [min or %B]) MS2 score: 32.45
21127740YIVFVTNYPLTISGK857.97 (observed)26.15E+0533.41 (HPLC [min or %B]) MS2 score: 39.85
21127740YIVFVTNYPLTISGK857.97 (observed)23.78E+0540.81 (HPLC [min or %B]) MS2 score: 71.66

Compile date 12-23-2014© PADB initiative