PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5688ACSS1, ACAS2LAcetyl-coenzyme A synthetase 2-like, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002RGQDLGDTTTLEDPSVITEILSAFQKY 2    
18501002RGQDLGDTTTLEDPSVITEILSAFQKY 3    
18614015(K)AVITFNQGLR(G)      peptide count: 18
18614015(K)DNISDENMVVNELK(L)      peptide count: 4
18614015(K)GEAAFAFIVLK(D)      peptide count: 4
18614015(K)GLVHTQAGYLLYAAMTHK(L)      peptide count: 6
18614015(K)INQFYGAPTAVR(L)      peptide count: 26
18614015(K)IVDEAVK(S)      peptide count: 7
18614015(K)KIVDEAVK(S)      peptide count: 8
18614015(K)LSVATK(I)      peptide count: 5
18614015(K)SCPTVQHVLVAHR(T)      peptide count: 10
18614015(K)SPETIALIWER(D)      peptide count: 19
18614015(K)SPETIALIWERDEPGTEVR(I)      peptide count: 9
18614015(K)VPMGSLDIPLEQEMAK(E)      peptide count: 5
18614015(K)YAVPDQILVVK(R)      peptide count: 11
18614015(K)YGDAWVK(K)      peptide count: 3
18614015(R)AYPGYYFTGDGAHR(T)      peptide count: 12
18614015(R)DEPGTEVR(I)      peptide count: 11
18614015(R)DTLVWDTPYHTVWDCDFR(T)      peptide count: 4
18614015(R)ELLETTCR(L)      peptide count: 13
18614015(R)FVDAYFR(A)      peptide count: 31
18614015(R)GQDLGDTTTLEDPSVITEILSAFQK(Y)      peptide count: 85
18614015(R)GQDLGDTTTLEDPSVITEILSAFQKYEEQR(A)      peptide count: 1
18614015(R)HGVHR(G)      peptide count: 6
18614015(R)IGAIHTVVFAGFSAESLAGR(I)      peptide count: 10
18614015(R)ITYRELLETTCRLANTLK(R)      peptide count: 1
18614015(R)ITYRELLETTCRLANTLK(R)      peptide count: 2
18614015(R)LANTLK(R)      peptide count: 4
18614015(R)LANTLKR(H)      peptide count: 8
18614015(R)LGTAEIEDAMADHPAVPETAVIGYPHDIK(G)      peptide count: 4
18614015(R)LKINQFYGAPTAVR(L)      peptide count: 2
18614015(R)LPGCVPAAAQPGSYPALSAQAAQEPAAFWGPLAR(D)      peptide count: 5
18614015(R)MDDVINISGHR(L)      peptide count: 11
18614015(R)TDTKVPMGSLDIPLEQEMAK(E)      peptide count: 3
18614015(R)TEGGYYQITGR(M)      peptide count: 23
18614015(R)TIYGDHQR(F)      peptide count: 40
18614015(R)TLGSVGEPINHEAWEWLHK(V)      peptide count: 8
18614015(R)VAIYMPVSPLAVAAMLACAR(I)      peptide count: 10
18614015(R)VVELKK(I)      peptide count: 15
18614015(R)YWETVQR(L)      peptide count: 14
15253431DSAGDSDVVVQELK 2   Pept_E (Sonar search): 9.70E-03 
18563753FVDAYFR2    
18563753TLGSVGEPINHEAWEWLHJ4    
18563753TLGSVGEPINHEAWEWLHJ4    
18563753TYPGYYFTGDGAHR3    
18563753TYPGYYFTGDGAHR3    
18563753YAVPDQILVVJ3    

Compile date 12-23-2014© PADB initiative