PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5684ACPL2, UNQ370/PRO706, UNQ370Acid phosphatase-like protein 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
17723740RKPYHPKLEAFISHMSKG     deltaCN (delta correlation): 17723740 
16684767KPSEHSVRILYNGVDVTFHTSFCQDHHKRS3311.6384 (observed)3   peptide count: 2

Compile date 12-23-2014© PADB initiative