PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5681ACOX3, BRCOX, PRCOXAcyl-coenzyme A oxidase 3, peroxisomal

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KTIFSTLENDPLFARS 2    
18501002RGIQECREACGGHGYLAMNRF 3    
18501002RTGNITSEGTYNSPFKDVRQ 2    
18501002RTGNITSEGTYNSPFKDVRQ 3    
18614015(K)ADGELYK(N)      peptide count: 3
18614015(K)FLGSSK(A)      peptide count: 1
18614015(K)FWVGNLGK(T)      peptide count: 3
18614015(K)GPLSAYR(A)      peptide count: 3
18614015(K)LRELNFLR(C)      peptide count: 2
18614015(K)NLWAAVLQQNGVLER(A)      peptide count: 3
18614015(K)TIFSTLENDPLFAR(S)      peptide count: 4
18614015(K)TLLPMTGVMVGDIGK(K)      peptide count: 1
18614015(K)TVDFLEAYPGILGQK(F)      peptide count: 4
18614015(R)AAWWPEFSANK(S)      peptide count: 3
18614015(R)AMEDAILTLCEQLKDDAVALVDVIAPSDFVLNSPIAK(A)      peptide count: 4
18614015(R)CQFGPTDKEEIPVLEYPLQQWR(I)      peptide count: 1
18614015(R)EIHALASAGKPLASWTAQR(G)      peptide count: 3
18614015(R)GGYISGEQTGR(A)      peptide count: 11
18614015(R)GSDFEAR(N)      peptide count: 3
18614015(R)ILPYLAAAYALDHFSK(T)      peptide count: 4
18614015(R)LGASLGSLSSGR(I)      peptide count: 3
18614015(R)LRGDHSDQQAELGR(E)      peptide count: 18
18614015(R)QNLLDR(T)      peptide count: 2
18614015(R)SYGADLPLEK(L)      peptide count: 3
18614015(R)TGNITSEGTYNSPFK(D)      peptide count: 2
18614015(R)TGNITSEGTYNSPFKDVR(Q)      peptide count: 1
18614015(R)TTAHYDPDTQEFILHSPDFEAAK(F)      peptide count: 3
18614015(R)WLVCYLLQESHR(R)      peptide count: 1
21616181ELNFLR936.52593 (observed)   N-Term(iTRAQ4plex), N3(Deamidated) peptide count: 1

Compile date 12-23-2014© PADB initiative