PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5680ACOX2, BRCOXAcyl-coenzyme A oxidase 2, peroxisomal

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)ACTIAVR(Y)      peptide count: 1
18614015(K)AHCYFLTVR(N)      peptide count: 2
18614015(K)GFLPTLQK(A)      peptide count: 2
18614015(K)HLYFMTR(D)      peptide count: 3
18614015(K)ILEYQTQQQK(L)      peptide count: 4
18614015(K)LAWSLGWSEDGPER(I)      peptide count: 1
18614015(K)LDNEPEIQR(V)      peptide count: 2
18614015(K)LSGLPTLVTQAIASCTYEGENTVLYLQVAR(F)      peptide count: 3
18614015(K)MGFENIDNGFLR(L)      peptide count: 2
18614015(K)SPANTQENPAYK(K)      peptide count: 3
18614015(K)SPANTQENPAYKK(Y)      peptide count: 3
18614015(K)YIRPLMQSWKPK(L)      peptide count: 1
18614015(R)ACGGHGYSK(L)      peptide count: 1
18614015(R)DATQHTQTLMR(S)      peptide count: 3
18614015(R)DELYEDAVQK(R)      peptide count: 1
18614015(R)DELYEDAVQKR(F)      peptide count: 5
18614015(R)DFSLLPELHALSTGMK(A)      peptide count: 1
18614015(R)DPVFNLK(H)      peptide count: 3
18614015(R)ENMLSR(F)      peptide count: 1
18614015(R)FAEVLPDGTYQR(L)      peptide count: 3
18614015(R)HGMHAFIVPIR(S)      peptide count: 8
18614015(R)LFEWAQK(S)      peptide count: 3
18614015(R)LGTPQSNYLGMLVTR(V)      peptide count: 3
18614015(R)LRPSDPEAK(I)      peptide count: 5
18614015(R)LTNILDGGIPNTELR(R)      peptide count: 1
18614015(R)LTNILDGGIPNTELRR(R)      peptide count: 2
18614015(R)RVESLIQR(D)      peptide count: 3
18614015(R)SLEDHTPLPGITVGDIGPK(M)      peptide count: 2
18614015(R)SLGSDEQIAK(W)      peptide count: 4
18614015(R)TAFLDLLPLIR(K)      peptide count: 25
18614015(R)VLQNLCDLYALNGILTNSGDFLHDGFLSGAQVDMAR(T)      peptide count: 2
18614015(R)VQLLYK(G)      peptide count: 4
18614015(R)VSLGETWSR(E)      peptide count: 4
18614015(R)YAVIR(H)      peptide count: 2

Compile date 12-23-2014© PADB initiative