PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5679ACOX1, ACOXAcyl-coenzyme A oxidase 1, peroxisomal

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KFGYEEMDNGYLKM 2    
18501002KGGDFLEGNIITGAQMSQVNSRI 2    
18501002KKSPLNKTEVHQSYYKH 3    
18501002KLHMVNFVEPVGLNYSM*FIPTLLNQGTTAQQEKW 3    
18501002KLHMVNFVEPVGLNYSMFIPTLLNQGTTAQQEKW 3    
18501002KMREFGIADPEEIMWFKK 3    
18501002KYAQVKPDGTYVKPLSNKL 3    
18501002REFGIADPEEIMWFKK 2    
18501002REIENLILNDPDFQHEDYNFLTRS 3    
18501002REIENLILNDPDFQHEDYNFLTRS 2    
16446289REIGTHKPLPGITVGDIGPKF 2   peptide count: 1
18501002REIGTHKPLPGITVGDIGPKF 3    
18501002RGLETTATYDPKT 2    
18501002RILELLTVTRPNAVALVDAFDFKD 3    
16446289RINEGIGQGDLSELPELHALTAGLKA 2   peptide count: 1
18501002RIQPQQVAVWPTLVDINSLDSLTEAYKL 2    
18501002RRREIENLILNDPDFQHEDYNFLTRS 3    
18501002RSEPEPQILDFQTQQYKL 2    
18501002RYDGNVYENLFEWAKK 2    
18614015(K)ACTIAIR(Y)      peptide count: 3
18614015(K)DVTLGSVLGR(Y)      peptide count: 4
18614015(K)EVAWNLTSVDLVR(A)      peptide count: 4
18614015(K)FGYEEMDNGYLK(M)      peptide count: 1
18614015(K)GGDFLEGNIITGAQMSQVNSR(I)      peptide count: 3
18614015(K)HLKPLQSK(L)      peptide count: 18
18614015(K)HLKPLQSKL(-)      peptide count: 7
18614015(K)IYDQVQSGK(L)      peptide count: 35
18614015(K)KSPLNKTEVHESYYK(H)      peptide count: 3
18614015(K)LFPLLATAYAFHFLGR(Y)      peptide count: 29
18614015(K)LFPLLATAYAFHFLGRYIKETYMR(I)      peptide count: 1
18614015(K)LTYGTMVFVR(S)      peptide count: 3
18614015(K)LVGGMVSYLNDLPSQR(I)      peptide count: 15
18614015(K)NLQAQVSHR(K)      peptide count: 32
18614015(K)NLQAQVSHRK(S)      peptide count: 4
18614015(K)SKEVAWNLTSVDLVR(A)      peptide count: 3
18614015(K)SPLNKTEVHESYYK(H)      peptide count: 2
18614015(K)TEVHESYYK(H)      peptide count: 30
18614015(K)TQEFILNSPTVTSIK(W)      peptide count: 7
18614015(K)TSNHAIVLAQLITR(G)      peptide count: 2
18614015(K)VFADKLPK(I)      peptide count: 5
18614015(K)YAQVKPDGTYVKPLSNK(L)      peptide count: 7
18614015(R)AAATFNPELITHILDGSPENTR(R)      peptide count: 7
18614015(R)AAATFNPELITHILDGSPENTRR(R)      peptide count: 6
18614015(R)ASEAHCHYVTVK(V)      peptide count: 15
18614015(R)AVQAVLR(N)      peptide count: 7
18614015(R)EFGIADPEEIMWFK(N)      peptide count: 9
18614015(R)EIENLILNDPDFQHEDYNFLTR(S)      peptide count: 8
18614015(R)EIGTHKPLPGITVGDIGPK(F)      peptide count: 12
18614015(R)ENMLMK(Y)      peptide count: 1
18614015(R)FFMPAWNLEITGTYAQTEMGHGTHLR(G)      peptide count: 1
18614015(R)GLETTATYDPK(T)      peptide count: 15
18614015(R)ILELLTVTRPNAVALVDAFDFK(D)      peptide count: 18
18614015(R)ILELLTVTRPNAVALVDAFDFKDVTLGSVLGR(Y)      peptide count: 7
18614015(R)INESIGQGDLSELPELHALTAGLK(A)      peptide count: 3
18614015(R)IPRENMLMKYAQVKPDGTYVKPLSNK(L)      peptide count: 2
18614015(R)IQPQQVAVWPTLVDINSLDSLTEAYK(L)      peptide count: 1
18614015(R)LVEIAAK(N)      peptide count: 8
18614015(R)NLCLLYSLYGISQK(G)      peptide count: 7
18614015(R)QSEIKR(S)      peptide count: 1
18614015(R)SEPEPQILDFQTQQYK(L)      peptide count: 1
18614015(R)SFLVGSAAQSLSK(A)      peptide count: 15
18614015(R)YDGNVYENLFEWAK(K)      peptide count: 15
18614015(R)YDGNVYENLFEWAKK(S)      peptide count: 1
18614015(R)YEVAVK(K)      peptide count: 27
18614015(R)YEVAVKK(S)      peptide count: 2
18614015(R)YIKETYMR(I)      peptide count: 10

Compile date 12-23-2014© PADB initiative