PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5670ACO1, IRP1, IREB1Iron-responsive element binding protein 1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260AVLAESYER0.014471517 (delta mass [ppm])2   MS2 score: 29 
16709260DFNDPSQDPDFTQVVELDLK-0.657886266 (delta mass [ppm])2   MS2 score: 56 
16709260FVEFFGPGVAQLSIADR3.53194932 (delta mass [ppm])2   MS2 score: 74 
16948836FVEFFGPGVAQLSIADR1.3 (delta mass [ppm])2    
16948836GPFLLGIK0.1 (delta mass [ppm])2    
18501002KAVLAESYERI 2    
18501002KKNDIENILNWNVMQHKN 3    
18501002KNIEVPFKPARV 2    
18501002KQAPQTVHLPSGETLDVFDAAERY 3    
18501002KSIVDAYVLLNLGDSVTTDHISPAGNIARN 3    
18501002KSPPFFESLTLDLQPPKS 2    
18501002KYLQAVGMFRD 2    
16948836LFFWNSK0.4 (delta mass [ppm])2    
18501002MKNPFAHLAEPLDAAQPGKRF 3    
16709260NQDLEFER0.877579359 (delta mass [ppm])2   MS2 score: 36 
16948836QAPQTIHLPSGEILDVFDAAER1.2 (delta mass [ppm])3    
16709260QVGVVGK-1.936353041 (delta mass [ppm])1   MS2 score: 28 
18501002RFFNLNKLEDSRY 2    
18501002RIDFEKEPLGVNAQGRQ 2    
18501002RIDFEKEPLGVNAQGRQ 3    
18501002RSNLVGM*GVIPLEYLPGETADSLGLTGRE 2    
18501002RSNLVGMGVIPLEYLPGETADSLGLTGRE 2    
18501002RVILQDFTGVPAVVDFAAM*RD 2    
18501002RVILQDFTGVPAVVDFAAMRD 2    
18501002RYQQAGLPLIVLAGKEYGSGSSRD 3    
18501002RYTINIPEDLKPRM 3    
18501002RYTINIPEDLKPRM 2    
16948836SNLVGMGVIPLEYLPGENADALGLTGQER1 (delta mass [ppm])3    
16709260SNPFAHLAEPLDPVQPGKK-0.361442664 (delta mass [ppm])3   MS2 score: 32 
16948836VILQDFTGVPAVVDFAAMR0.3 (delta mass [ppm])2    
16948836VLLEAAIR0.3 (delta mass [ppm])2    
16948836YLQAVGMFR1.2 (delta mass [ppm])2    
16709260YQQAGLPLIVLAGK1.314410432 (delta mass [ppm])2   MS2 score: 54 
16948836YQQAGLPLIVLAGK1.7 (delta mass [ppm])2    
16684767KDFESCLGAKQ 2    
16684767KFFNLNKLEDSRY 2    
16684767KIETVNESWNALATPSDKLFFWNSKS 3    
16684767KKAVDAGLNVMPYIKT 2    
16684767KKDFESCLGAKQ 2    
16684767KKQDIENILHWNVTQHKN 3    
16684767KLGGDPEKINPVCPADLVIDHSIQVDFNRR 3    
16684767KQAPQTIHLPSGEILDVFDAAERY 3    
16684767KSPPFFENLTLDLQPPKS 2    
16684767RDFNDPSQDPDFTQVVELDLKT 2    
16684767RIDFEKEPLGVNAKG 2    
16684767RNCDEFLVKK 2    
16684767RSNLVGMGVIPLEYLPGENADALGLTGQERY 2    
16684767RVILQDFTGVPAVVDFAAMRD 2    
16684767RYQQAGLPLIVLAGKE 2    
18614015(K)AVLAESYER(I)      peptide count: 1
18614015(K)EPLGVNAQGR(Q)      peptide count: 1
18614015(K)FVEFFGPGVAQLSIADR(A)      peptide count: 1
18614015(K)GFQVAPDR(H)      peptide count: 1
18614015(K)GPFLLGIK(A)      peptide count: 2
18614015(K)IETVNK(S)      peptide count: 1
18614015(K)NQDLEFER(N)      peptide count: 1
18614015(K)TFQAVMR(F)      peptide count: 1
18614015(K)VAVSEMK(K)      peptide count: 1
18614015(R)ANYLASPPLVIAYAIAGTVR(I)      peptide count: 1
18614015(R)DEIQAVER(Q)      peptide count: 1
18614015(R)EFNSYGSR(R)      peptide count: 1
18614015(R)QVFLK(Y)      peptide count: 1
18614015(R)RGNDAIMAR(G)      peptide count: 1
18614015(R)VILQDFTGVPAVVDFAAMR(D)      peptide count: 3
18614015(R)YLTNR(G)      peptide count: 1
18614015(R)YQQAGLPLIVLAGK(E)      peptide count: 1
21616181AVLAESYER1181.62407 (observed)   N-Term(iTRAQ4plex)MS2 score: 45peptide count: 2
21616181DFNDTSQDPDFTQVVELDLK2614.28446 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex)peptide count: 2
21616181DFNDTSQDPDFTQVVELDLK2614.28977 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex) peptide count: 1
21616181FVEFFGPGVAQLSIADR1997.06998 (observed)   N-Term(iTRAQ4plex)peptide count: 3
21616181VILQDFTGVPAVVDFAAMR2193.19571 (observed)   N-Term(iTRAQ4plex)MS2 score: 42peptide count: 1
21616181VILQDFTGVPAVVDFAAMR2209.18558 (observed)   N-Term(iTRAQ4plex), M18(Oxidation)peptide count: 3
21616181VLLEAAVR1014.6447 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181YQQAGLPLIVLAGK1759.0748 (observed)   N-Term(iTRAQ4plex), K14(iTRAQ4plex)peptide count: 2
21127740GPFLLGIK422.77 (observed)21.63E+0632.55 (HPLC [min or %B]) MS2 score: 39.09
21127740VLLEAAIR442.78 (observed)22.90E+0520.56 (HPLC [min or %B]) MS2 score: 34.06
21127740VLLEAAIR442.78 (observed)28.36E+0629.05 (HPLC [min or %B]) MS2 score: 30.69
21127740YQQAGLPLIVLAGK735.94 (observed)23.91E+0536.24 (HPLC [min or %B]) MS2 score: 31.56
21127740YQQAGLPLIVLAGK735.94 (observed)22.16E+0536.68 (HPLC [min or %B]) MS2 score: 38.64
21127740YQQAGLPLIVLAGK735.94 (observed)21.14E+0635.96 (HPLC [min or %B]) MS2 score: 25.74
21127740YQQAGLPLIVLAGK735.94 (observed)25.59E+0536.67 (HPLC [min or %B]) MS2 score: 64.17
21127740YQQAGLPLIVLAGK735.93 (observed)22.56E+0640.43 (HPLC [min or %B]) MS2 score: 50.01
21127740YQQAGLPLIVLAGK735.94 (observed)24.17E+0532.04 (HPLC [min or %B]) MS2 score: 36.1
21127740YQQAGLPLIVLAGK735.93 (observed)22.04E+0640.5 (HPLC [min or %B]) MS2 score: 62.77
21127740AVLAESYER519.27 (observed)21.00E+0617.88 (HPLC [min or %B]) MS2 score: 27.15
21127740DEIQAVER480.24 (observed)23.40E+0618.72 (HPLC [min or %B]) MS2 score: 35.95
21127740DFESCLGAK513.73 (observed)27.11E+0521.28 (HPLC [min or %B]) MS2 score: 25.25
21127740FVEFFGPGVAQLSIADR926.99 (observed)21.28E+0634.97 (HPLC [min or %B]) MS2 score: 54.83
21127740FVEFFGPGVAQLSIADR926.99 (observed)23.69E+0535.36 (HPLC [min or %B]) MS2 score: 81.2
21127740GPFLLGIK422.77 (observed)22.32E+0632 (HPLC [min or %B]) MS2 score: 41.82
21127740GPFLLGIK422.77 (observed)26.34E+0527.09 (HPLC [min or %B]) MS2 score: 41.12
21127740GPFLLGIK422.77 (observed)22.69E+0636.23 (HPLC [min or %B]) MS2 score: 44.21
21127740GPFLLGIK422.77 (observed)29.08E+0427.81 (HPLC [min or %B]) MS2 score: 28.46
21127740GPFLLGIK422.77 (observed)25.95E+0532.75 (HPLC [min or %B]) MS2 score: 38.98
21127740NQDLEFER525.74 (observed)26.30E+0622.69 (HPLC [min or %B]) MS2 score: 30.7
21127740NQDLEFER525.75 (observed)25.67E+0519.4 (HPLC [min or %B]) MS2 score: 33.81
21127740QAPQTIHLPSGEILDVFDAAER803.41 (observed)33.33E+0642.08 (HPLC [min or %B])Deamidation (NQ)MS2 score: 36.3
21127740VLLEAAIR442.78 (observed)24.56E+0625.2 (HPLC [min or %B]) MS2 score: 36.36
21127740YLQAVGMFR550.78 (observed)23.73E+0524.13 (HPLC [min or %B])Oxidation (M)MS2 score: 44.64
23308193ANYLASPPLVIAYAIAGTIR     MS2 score: 77,000peptide count: 8
23376485ANYLASPPLVIAYAIAGTIR1037.591 (observed)   :::::::::::::::::::::
23376485ANYLASPPLVIAYAIAGTIR692.066 (observed)   :::::::::::::::::::::
23308193DFNDPSQDPDFTQVVELDLK     MS2 score: 77,000peptide count: 8
23308193FVEFFGPGVAQLSIADR     MS2 score: 77,000peptide count: 8
23376485FVEFFGPGVAQLSIADR926.985 (observed)   ::::::::::::::::::
23308193GPFLLGIK     MS2 score: 77,000peptide count: 8
23308193LFFWNSK     MS2 score: 77,000peptide count: 8
23308193VILQDFTGVPAVVDFAAMR     MS2 score: 77,000peptide count: 8
23308193YLQAVGMFR     MS2 score: 77,000peptide count: 8
23376485YQQAGLPLIVLAGK735.944 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.935 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.94 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.94 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.94 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.941 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.94 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.941 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.94 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.943 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.938 (observed)   :::::::::::::::
23376485YQQAGLPLIVLAGK735.944 (observed)   :::::::::::::::
23308193YTIIIPENLKPQMK     MS2 score: 77,000peptide count: 8

Compile date 12-23-2014© PADB initiative