PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5665Acnat2Acyl-coenzyme A amino acid N-acyltransferase 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)IQQPGIGVISTSK(G)      peptide count: 1
18614015(K)TNEAGEVDLEK(T)      peptide count: 1
18614015(R)EQIQEGR(V)      peptide count: 1
18614015(R)IQVHDSGALLFRYTTQYLHNKLNSQNILPVEK(A)      peptide count: 3

Compile date 12-23-2014© PADB initiative