PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5662ACE2, UNQ868/PRO1885, UNQ868Angiotensin-converting enzyme 2 precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260AYEWNDNEMYLFR0.08721553 (delta mass [ppm])2   MS2 score: 30 
16948836AYEWNDNEMYLFR2.8 (delta mass [ppm])2    
16948836DMNDNAPTIEIR1.2 (delta mass [ppm])2    
16948836FWTNLYSLTVPFGQK2.6 (delta mass [ppm])2    
16948836FWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQR2.7 (delta mass [ppm])3    
16948836GLFTISPETGEIQVK3.3 (delta mass [ppm])2    
16709260ISFNFFVTAPK1.272765961 (delta mass [ppm])2   MS2 score: 70 
16948836ISFNFFVTAPK1.2 (delta mass [ppm])2    
16948836ISFNFFVTAPK0.8 (delta mass [ppm])2    
16948836LEVGAPYLR0.1 (delta mass [ppm])2    
16948836LLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDR1.3 (delta mass [ppm])4    
16948836LMNAYPSYISPIGCLPAHLLGDMWGR2.5 (delta mass [ppm])3    
16709260LNTILNTMSTIYSTGK-0.97442482 (delta mass [ppm])2   MS2 score: 67 
16948836LNTILNTMSTIYSTGK1.1 (delta mass [ppm])2    
16948836LNTILNTMSTIYSTGK1.9 (delta mass [ppm])2    
16948836LNTILNTMSTIYSTGK1.3 (delta mass [ppm])2    
16948836LWAWESWR0.9 (delta mass [ppm])2    
16948836LWAWESWR1.4 (delta mass [ppm])2    
16948836NMNVRPLLNYFEPLFTWLK1.7 (delta mass [ppm])3    
16709260NSFVGWSTDWSPYADQSIK-0.893465103 (delta mass [ppm])2   MS2 score: 82 
16948836NSFVGWSTDWSPYADQSIK0.2 (delta mass [ppm])2    
16948836NSFVGWSTDWSPYADQSIK3.2 (delta mass [ppm])2    
16948836NTGLITVQGPVDR2 (delta mass [ppm])2    
16948836NTGLITVQGPVDREDLSTLR2.2 (delta mass [ppm])3    
16948836PLLNYFEPLFTWLK2 (delta mass [ppm])2    
16948836PLLNYFEPLFTWLK0.5 (delta mass [ppm])2    
16948836PLLNYFEPLFTWLK2.2 (delta mass [ppm])2    
16948836QALTIVGTLPFTYMLEK2.2 (delta mass [ppm])2    
16948836QALTIVGTLPFTYMLEK3 (delta mass [ppm])2    
16948836QLRPLYEEYVVLK0.7 (delta mass [ppm])3    
16948836SEPWTLALENVVGAK1.1 (delta mass [ppm])2    
16948836SEPWTLALENVVGAK1.3 (delta mass [ppm])2    
16948836SGENPYASIDISK2.1 (delta mass [ppm])2    
16948836TGDIFTTETSIDR3.1 (delta mass [ppm])2    
16948836TLLETLLGHSLDTPLDIDIAGD2.3 (delta mass [ppm])2    
16948836TLLETLLGHSLDTPLDIDIAGDPEYER0.4 (delta mass [ppm])3    
16709260TLYQFQFQEALCQAAK0.871492035 (delta mass [ppm])2   MS2 score: 28 
16948836TLYQFQFQEALCQAAK1.4 (delta mass [ppm])2    
16709260VANLKPR-0.110358942 (delta mass [ppm])2   MS2 score: 29 
16948836VPEEQPPNTLIGSLAADYGFPDVGHLYK3.6 (delta mass [ppm])3    
16948836VQDGGSPPR1.7 (delta mass [ppm])2    
16948836VTVLDTNDNAPK0.2 (delta mass [ppm])2    
16948836YFLQTTTPLDYEK2.1 (delta mass [ppm])2    
18614015(K)SALGANAYEWTNNEMFLFRSSVAYAMRK(Y)      peptide count: 1
18614015(R)QPFLLR(N)      peptide count: 1
18614015(R)VSDLKPR(V)      peptide count: 1
21127740AYEWNDNEMYLFR883.88 (observed)23.24E+0628.26 (HPLC [min or %B])Oxidation (M)MS2 score: 67.12
21127740AYEWNDNEMYLFR875.88 (observed)24.40E+0631.75 (HPLC [min or %B]) MS2 score: 55.02
21127740ISFNFFVTAPK635.85 (observed)21.34E+0633.08 (HPLC [min or %B]) MS2 score: 43.12
21127740ISFNFFVTAPK635.85 (observed)25.53E+0533.19 (HPLC [min or %B]) MS2 score: 82.38
21127740ISFNFFVTAPK635.84 (observed)22.33E+0537.65 (HPLC [min or %B]) MS2 score: 53.41
21127740ISFNFFVTAPK635.85 (observed)21.21E+0537.24 (HPLC [min or %B]) MS2 score: 62.39
21127740ISFNFFVTAPK635.85 (observed)23.99E+0537.5 (HPLC [min or %B]) MS2 score: 52.43
21127740ISFNFFVTAPK635.85 (observed)26.17E+0533.32 (HPLC [min or %B]) MS2 score: 64.68
21127740LNTILNTMSTIYSTGK886.96 (observed)21.03E+0623.49 (HPLC [min or %B])Oxidation (M)MS2 score: 53.88
21127740LNTILNTMSTIYSTGK878.96 (observed)21.99E+0632.7 (HPLC [min or %B]) MS2 score: 72
21127740LWAWESWR567.28 (observed)22.58E+0631.56 (HPLC [min or %B]) MS2 score: 29.41
21127740LWAWESWR567.28 (observed)23.99E+0631.39 (HPLC [min or %B]) MS2 score: 26.58
21127740LWAWESWR567.28 (observed)25.68E+0531.75 (HPLC [min or %B]) MS2 score: 38.81
21127740SEPWTLALENVVGAK807.43 (observed)23.71E+0635.59 (HPLC [min or %B]) MS2 score: 62.44
21127740SEPWTLALENVVGAK807.43 (observed)21.25E+0635.22 (HPLC [min or %B]) MS2 score: 40.07
21127740SEPWTLALENVVGAK538.62 (observed)31.41E+0635.47 (HPLC [min or %B]) MS2 score: 51.02
21127740SEPWTLALENVVGAK807.43 (observed)23.16E+0535.66 (HPLC [min or %B]) MS2 score: 46.24
21127740SEPWTLALENVVGAK807.43 (observed)21.11E+0636.2 (HPLC [min or %B]) MS2 score: 69.7
21127740SEPWTLALENVVGAK807.43 (observed)27.34E+0536.31 (HPLC [min or %B]) MS2 score: 49.71
21127740SGENPYASIDISK690.84 (observed)25.93E+0516.76 (HPLC [min or %B]) MS2 score: 48.5
21127740SGENPYASIDISK690.84 (observed)21.48E+0618.59 (HPLC [min or %B]) MS2 score: 53.07
21127740AYEWNDNEMYLFR883.88 (observed)22.52E+0632.79 (HPLC [min or %B])Oxidation (M)MS2 score: 53.78
21127740ISFNFFVTAPK635.85 (observed)25.11E+0533.59 (HPLC [min or %B]) MS2 score: 57.06
21127740ISFNFFVTAPK635.84 (observed)29.21E+0542.81 (HPLC [min or %B]) MS2 score: 55.26
21127740ISFNFFVTAPK635.85 (observed)21.29E+0637.97 (HPLC [min or %B]) MS2 score: 71.48
21127740ISFNFFVTAPK635.85 (observed)22.84E+0633.12 (HPLC [min or %B]) MS2 score: 41.44
21127740ISFNFFVTAPK635.85 (observed)23.07E+0537.11 (HPLC [min or %B]) MS2 score: 45.92
21127740ISFNFFVTAPK635.84 (observed)21.12E+0643.22 (HPLC [min or %B]) MS2 score: 71.34
21127740LFNMLR397.22 (observed)24.88E+0522.61 (HPLC [min or %B]) MS2 score: 20.42
21127740LWAWESWR567.28 (observed)23.82E+0536.32 (HPLC [min or %B]) MS2 score: 33.84
21127740LWAWESWR567.28 (observed)27.28E+0536.55 (HPLC [min or %B]) MS2 score: 35.22
21127740LWAWESWR567.28 (observed)23.59E+0536.24 (HPLC [min or %B]) MS2 score: 28.9
21127740LWAWESWR567.28 (observed)22.02E+0631.69 (HPLC [min or %B]) MS2 score: 29.96
21127740LWAWESWR567.28 (observed)22.18E+0532.05 (HPLC [min or %B]) MS2 score: 29.06
21127740NQMILFGEEDVR733.85 (observed)21.45E+0622.03 (HPLC [min or %B])Oxidation (M)MS2 score: 55.73
21127740NSFVGWSTDWSPYADQSIK1094.51 (observed)21.79E+0632.17 (HPLC [min or %B]) MS2 score: 109.94
21127740QALTIVGTLPFTYMLEK962.51 (observed)29.78E+0542.12 (HPLC [min or %B])Oxidation (M); Pyro-glu (N-term Q)MS2 score: 34.03
21127740QLRPLYEEYVVLK816.96 (observed)27.09E+0632.61 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 52.77
21127740QLRPLYEEYVVLK825.47 (observed)25.75E+0530.75 (HPLC [min or %B]) MS2 score: 51.17
21127740SEPWTLALENVVGAK807.43 (observed)29.88E+0544.7 (HPLC [min or %B]) MS2 score: 58.04
21127740SGENPYASIDISK690.83 (observed)29.17E+0626.77 (HPLC [min or %B]) MS2 score: 43.04
21127740SGENPYASIDISK690.83 (observed)22.86E+0622.8 (HPLC [min or %B]) MS2 score: 76.04
21127740SGENPYASIDISK690.84 (observed)26.76E+0522.42 (HPLC [min or %B]) MS2 score: 68.62
21127740TLYQFQFQEALCQAAK649.32 (observed)35.38E+0631.42 (HPLC [min or %B]) MS2 score: 51.91

Compile date 12-23-2014© PADB initiative