PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5661ACADSBAcyl-CoA dehydrogenase, short/branched chain specific, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KFAQEHVAPLVSSMDENSKM 3    
18501002KFAQEHVAPLVSSMDENSKM 2    
18501002KIGTIYEGASNIQLNTIAKH 2    
18501002KKFAQEHVAPLVSSM*DENSKM 3    
18501002KKFAQEHVAPLVSSMDENSKM 3    
18501002KSSQPEALVSLTNNAVAFAPLQTLTDEEIM*M*KQ 2    
18501002KSSQPEALVSLTNNAVAFAPLQTLTDEEIMMKQ 2    
18501002RIFDFQGLQHQVAQVATQLEATRL 3    
18501002RIFDFQGLQHQVAQVATQLEATRL 2    
18614015(K)ATYLPK(L)      peptide count: 5
18614015(K)DYPVEK(F)      peptide count: 15
18614015(K)FAQEHVAPLVSSMDENSK(M)      peptide count: 5
18614015(K)FAQEHVAPLVSSMDENSKMEK(S)      peptide count: 1
18614015(K)HASEEQK(A)      peptide count: 8
18614015(K)HIDAEY(-)      peptide count: 4
18614015(K)IGHGYK(Y)      peptide count: 7
18614015(K)IGTIYEGASNIQLNTIAK(H)      peptide count: 8
18614015(K)KFAQEHVAPLVSSMDENSK(M)      peptide count: 2
18614015(K)KFAQEHVAPLVSSMDENSKMEK(S)      peptide count: 2
18614015(K)LGSFCLSEAGAGSDSFAMK(T)      peptide count: 1
18614015(K)MWISHAEHAELFLVFANVDPSSGYR(G)      peptide count: 2
18614015(K)RIFDFQGLQHQVAQVATQLEATR(L)      peptide count: 2
18614015(K)SGNYYVLNGSK(M)      peptide count: 19
18614015(K)SSQPEALVSLTNNAVAFAPLQTLTDEEIMMK(Q)      peptide count: 4
18614015(K)SSQPEALVSLTNNAVAFAPLQTLTDEEIMMK(Q)      peptide count: 4
18614015(K)VDASVALLCDIQNTIINNLFR(K)      peptide count: 82
18614015(K)VDASVALLCDIQNTIINNLFR(K)      peptide count: 10
18614015(K)VPETNILGK(I)      peptide count: 16
18614015(K)YAIGSLNEGR(I)      peptide count: 10
18614015(K)YYASEVAGLTTSK(C)      peptide count: 11
18614015(R)ASSTCQLTFENVK(V)      peptide count: 6
18614015(R)DTEGFQIGK(R)      peptide count: 4
18614015(R)DTEGFQIGKR(E)      peptide count: 4
18614015(R)GITCFLVDR(D)      peptide count: 5
18614015(R)GITCFLVDRDTEGFQIGK(R)      peptide count: 3
18614015(R)IFDFQGLQHQVAQVATQLEATR(L)      peptide count: 74
18614015(R)IFDFQGLQHQVAQVATQLEATRLLTYNAAR(L)      peptide count: 1
18614015(R)IGIAAQMLGLAQGCFDYTIPYIK(E)      peptide count: 32
18614015(R)KHASEEQK(A)      peptide count: 8
18614015(R)LLTYNAAR(L)      peptide count: 16
18614015(R)LVEAGRPFIK(E)      peptide count: 19
18614015(R)MQFGK(R)      peptide count: 1
15253431LFDFQGLQHQVAHVATQLEAAR 3   Pept_E (Sonar search): 2.80E-05 
23376485ATYLPQLTTEK632.846 (observed)   ::::::::::::
23376485ATYLPQLTTEK632.845 (observed)   ::::::::::::
23376485VPEANILGQIGHGYK532.625 (observed)   ::::::::::::::::

Compile date 12-23-2014© PADB initiative