PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5660ACAD11Acyl-CoA dehydrogenase family member 11

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AAHSIDTLGSASAR(K)      peptide count: 7
18614015(K)AEGLWNLFLPAVSGLSQVDYALIAEETGK(C)      peptide count: 7
18614015(K)ALFSIGFPVAKPLLYCR(D)      peptide count: 2
18614015(K)EIAMIK(V)      peptide count: 1
18614015(K)EVAEYYAQSGNSAEK(W)      peptide count: 3
18614015(K)GSQAYVLR(K)      peptide count: 4
18614015(K)IAIVLGR(T)      peptide count: 2
18614015(K)IDREFK(I)      peptide count: 2
18614015(K)KLYEHEVVAHWIAK(S)      peptide count: 2
18614015(K)KQWLEPLLR(G)      peptide count: 1
18614015(K)KWWSSGAGNPK(C)      peptide count: 2
18614015(K)LAGISQGVYR(R)      peptide count: 3
18614015(K)LDNIVFHPK(E)      peptide count: 7
18614015(K)LKEIAK(A)      peptide count: 2
18614015(K)LKEIAK(A)      peptide count: 4
18614015(K)MELQDQAR(R)      peptide count: 13
18614015(K)NLPDSDSEECLVHGDFK(L)      peptide count: 1
18614015(K)QHVFPAEK(E)      peptide count: 7
18614015(K)QWLEPLLR(G)      peptide count: 7
18614015(K)QYQASAHQSIPAMDQLSTWLMK(N)      peptide count: 1
18614015(K)RQVSTWTK(Q)      peptide count: 2
18614015(K)SQLFAQSR(R)      peptide count: 5
18614015(K)WGHPLVIEK(L)      peptide count: 1
18614015(K)WWSSGAGNPK(C)      peptide count: 2
18614015(K)YGTGVGYCK(R)      peptide count: 2
18614015(R)AAIYVSVAETLAWLHSLDIR(S)      peptide count: 13
18614015(R)AVLTVTQYR(S)      peptide count: 7
18614015(R)DASVIGTEFYVMEHVQGR(I)      peptide count: 3
18614015(R)DFSIPGVSSAER(A)      peptide count: 1
18614015(R)DGGGYIVNGK(K)      peptide count: 3
18614015(R)DGGGYIVNGKK(W)      peptide count: 5
18614015(R)GFEISQGR(L)      peptide count: 4
18614015(R)GIDPNLPNWNFFMALSFFK(L)      peptide count: 6
18614015(R)GQEVLTR(V)      peptide count: 1
18614015(R)GSHIPENTGIPLMEELISIYCHR(R)      peptide count: 8
18614015(R)IHHCMR(L)      peptide count: 1
18614015(R)ILQIMCDR(A)      peptide count: 2
18614015(R)KEIAMIK(V)      peptide count: 5
18614015(R)KKPPGSLLPK(A)      peptide count: 1
18614015(R)LADGPDEVHLSAIAK(M)      peptide count: 5
18614015(R)LALEELR(S)      peptide count: 6
18614015(R)LTARM(-)      peptide count: 5
18614015(R)QVSTWTK(Q)      peptide count: 2
18614015(R)RGIDPNLPNWNFFMALSFFK(L)      peptide count: 1
18614015(R)RGQEVLTR(V)      peptide count: 5
18614015(R)SGQSNPTFFLQK(G)      peptide count: 4
18614015(R)SLEAYLNQHLPGFGSDSR(A)      peptide count: 5
18614015(R)SLQLDK(L)      peptide count: 2
18614015(R)TESPSASR(H)      peptide count: 1
18614015(R)TVGLAER(I)      peptide count: 1
18614015(R)VIAVLDWELSTFGHPLTDLAHLSLFYYWPR(T)      peptide count: 1
18614015(R)VPASNLILGEGR(G)      peptide count: 10

Compile date 12-23-2014© PADB initiative