PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5659ACAD10Acyl-CoA dehydrohenase family member 10

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16684767KPPGTLLPSAHAIEREFRI1892.1509 (observed)2   peptide count: 1
18614015(K)AAALEMAMIK(M)      peptide count: 3
18614015(K)AAHLMDVAGNK(A)      peptide count: 18
18614015(K)AAHLMDVAGNK(A)      peptide count: 18
18614015(K)AEGLWNLFLPLETDPEK(K)      peptide count: 12
18614015(K)AEGLWNLFLPLETDPEK(K)      peptide count: 12
18614015(K)AEGLWNLFLPLETDPEK(K)      peptide count: 12
18614015(K)AEGLWNLFLPLETDPEKK(Y)      peptide count: 23
18614015(K)AEGLWNLFLPLETDPEKK(Y)      peptide count: 23
18614015(K)AEGLWNLFLPLETDPEKK(Y)      peptide count: 23
18614015(K)ELEALLGFPLHLGVPNTRPVR(K)      peptide count: 2
18614015(K)ENIILGPGR(A)      peptide count: 2
18614015(K)ENIILGPGR(A)      peptide count: 2
18614015(K)GGLVISPEGLSPAVR(K)      peptide count: 3
18614015(K)GGLVISPEGLSPAVR(K)      peptide count: 3
18614015(K)GGLVISPEGLSPAVR(K)      peptide count: 3
18614015(K)GLQTAVLTNNFHLSSGESFLPLDR(K)      peptide count: 1
18614015(K)LGIPTVEEYFR(M)      peptide count: 4
18614015(K)LTESMAELAWDFATK(E)      peptide count: 1
18614015(K)LTESMAELAWDFATK(E)      peptide count: 1
18614015(K)LTESMAELAWDFATK(E)      peptide count: 1
18614015(K)LYEQLVQFIEQK(V)      peptide count: 8
18614015(K)LYEQLVQFIEQK(V)      peptide count: 8
18614015(K)LYEQLVQFIEQK(V)      peptide count: 8
18614015(K)MVVPSMANQVIDR(A)      peptide count: 3
18614015(K)QGDYIPR(Q)      peptide count: 1
18614015(K)TAALDIAMIK(M)      peptide count: 1
18614015(K)TDPQAPR(H)      peptide count: 1
18614015(K)TDPQAPR(H)      peptide count: 1
18614015(K)TDPQAPR(H)      peptide count: 1
18614015(K)VAASLGIHTIK(V)      peptide count: 3
18614015(K)VDRPETAVK(E)      peptide count: 11
18614015(K)VYPLEPELQR(H)      peptide count: 1
18614015(K)VYPLEPELQR(H)      peptide count: 1
18614015(K)VYPLEPELQR(H)      peptide count: 1
18614015(K)WWTSGILDPR(C)      peptide count: 1
18614015(R)AAETSSIPAMER(L)      peptide count: 6
18614015(R)AFEIAQGR(L)      peptide count: 5
18614015(R)AIQAFGAAGLSSDYPLAQFFGWAQTLR(L)      peptide count: 2
18614015(R)AIQAFGAAGLSSDYPLAQFFGWAR(A)      peptide count: 4
18614015(R)ALALMK(T)      peptide count: 2
18614015(R)ALALMK(T)      peptide count: 2
18614015(R)EAIYTAMNQVLCR(I)      peptide count: 1
18614015(R)FADGPDEVHQLTVAK(M)      peptide count: 1
18614015(R)FKDVR(V)      peptide count: 4
18614015(R)GFEIAQGR(L)      peptide count: 1
18614015(R)GFRDQDVTK(L)      peptide count: 4
18614015(R)IHHCMR(L)      peptide count: 1
18614015(R)IHSCFAMTDRK(V)      peptide count: 1
18614015(R)IHSCFAMTDRK(V)      peptide count: 1
18614015(R)IHSVDLQATSLDSFGK(Q)      peptide count: 2
18614015(R)KKPSGTLLPSAHAIER(E)      peptide count: 3
18614015(R)KLYEQLVQFIEQK(V)      peptide count: 10
18614015(R)KLYEQLVQFIEQK(V)      peptide count: 10
18614015(R)KLYEQLVQFIEQK(V)      peptide count: 10
18614015(R)LGDDQLK(V)      peptide count: 2
18614015(R)LIGYSER(A)      peptide count: 14
18614015(R)LIGYSER(A)      peptide count: 14
18614015(R)LIQWLPLHLPR(Q)      peptide count: 2
18614015(R)LQEPAAR(R)      peptide count: 4
18614015(R)LSLQPSEAIFLDDLGSNLK(V)      peptide count: 3
18614015(R)SCFAMTEPQVASSDASNIEASIKEEDGCYVINGHK(W)      peptide count: 3
18614015(R)SLTGQASSATAQQSGK(L)      peptide count: 10
18614015(R)SRVEIEQAR(L)      peptide count: 22
18614015(R)SRVEIEQAR(L)      peptide count: 22
18614015(R)TAFGKPLVEQGTILADIAR(S)      peptide count: 8
18614015(R)TAFGKPLVEQGTILADIAR(S)      peptide count: 8
18614015(R)TTLVHGDFR(L)      peptide count: 2
18614015(R)VAAILQGVYK(R)      peptide count: 2
18614015(R)VEIEQAR(L)      peptide count: 2
18614015(R)VEIEQAR(L)      peptide count: 2
18614015(R)WLVPLLEGR(I)      peptide count: 8
18614015(R)WLVPLLEGR(I)      peptide count: 8
18614015(R)WLVPLLEGR(I)      peptide count: 8
18614015(R)WSPSPLIEDLK(E)      peptide count: 3
18614015(R)WSPSPLIEDLK(E)      peptide count: 3
18614015(R)WSPSPLIEDLK(E)      peptide count: 3
18614015(R)WTHSGGR(S)      peptide count: 1
18614015(R)WTHSGGR(S)      peptide count: 1
UNPUBLISHED_1R.ASETSTIPAMER.L    MS2 score: 1   
UNPUBLISHED_1R.KKPPGTLLPSAHAIER.E    MS2 score: 16   
UNPUBLISHED_1R.KKPPGTLLPSAHAIER.E    MS2 score: 17   
UNPUBLISHED_1R.LGPGR.I    MS2 score: 8   
UNPUBLISHED_1R.LGPGR.I    MS2 score: 10   
UNPUBLISHED_1R.YGTEAQKAR.W    MS2 score: 3   

Compile date 12-23-2014© PADB initiative