PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5657ACADVL, VLCADAcyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16446289KASNTAEVFFDGVRVPSENVLGEVGSGFKV 3   peptide count: 1
18501002KELGAFGLQVPSELGGLGLSNTQYARL 2    
18501002KELGAFGLQVPSELGGLGLSNTQYARL 3    
16446289KELGAFGLQVPSELGGVGLCNTQYARL 2   peptide count: 1
16446289KGIVNEQFLLQRL 2   peptide count: 1
18501002KGIVNEQFLLQRL 2    
18501002KGQLTIDQVFPYPSVLSEEQAQFLKE 2    
18501002KGQLTIDQVFPYPSVLSEEQAQFLKE 3    
16446289KGQLTTDQVFPYPSVLNEEQTQFLKE 2   peptide count: 3
18501002KIWISNGGLADIFTVFAKT 2    
18501002KKGIVNEQFLLQRL 2    
16446289KLWISNGGLADIFTVFAKT 2   peptide count: 1
16446289KTPVTDPATGAVKE 2   peptide count: 2
16446289KTPVTDPATGAVKEKI 3   peptide count: 1
18501002KVEDDTLQGLKELGAFGLQVPSELGGLGLSNTQYARL 3    
16446289RAGLGSGLSLSGLVHPELSRS 2   peptide count: 2
16446289RALEQFATVVEAKL 2   peptide count: 1
18501002REATQAVLDKPETLSSDASTRE 3    
18501002REATQAVLDKPETLSSDASTRE 2    
18501002RFFEEVNDPAKNDALEKV 2    
16446289RFFEEVNDPAKNDALEM*VEETTWQGLKE 3   peptide count: 1
16446289RFFEEVNDPAKNDALEMVEETTWQGLKE 3   peptide count: 1
18501002RFGMAATLAGTM*KS 2    
18501002RIFEGANDILRL 2    
18501002RIRENMASLQSSPQHQELFRN 3    
18501002RIRENMASLQSSPQHQELFRN 2    
18501002RRTGIGSGLSLSGIVHPELSRS 3    
18501002RSGELAVQALDQFATVVEAKL 2    
18501002RTGIGSGLSLSGIVHPELSRS 3    
16446289RVPSENVLGEVGSGFKV 2   peptide count: 5
18614015(K)AMVENGGLVTGNPLGI(-)      peptide count: 31
18614015(K)ASNTSEVYFDGVK(V)      peptide count: 40
18614015(K)ASNTSEVYFDGVKVPSENVLGEVGDGFK(V)      peptide count: 2
18614015(K)AVDHATNR(T)      peptide count: 54
18614015(K)DAATGAVK(E)      peptide count: 12
18614015(K)DFQIEAAISK(I)      peptide count: 15
18614015(K)EKITAFVVER(S)      peptide count: 2
18614015(K)ELGAFGLQVPSELGGLGLSNTQYAR(L)      peptide count: 72
18614015(K)ELTGLGNALK(N)      peptide count: 25
18614015(K)ELVGPVAR(F)      peptide count: 47
18614015(K)EPGVER(V)      peptide count: 5
18614015(K)GILLYGTK(A)      peptide count: 19
18614015(K)GIVNEQFLLQR(L)      peptide count: 29
18614015(K)GKELTGLGNALK(N)      peptide count: 14
18614015(K)GQLTIDQVFPYPSVLSEEQAQFLK(E)      peptide count: 43
18614015(K)GQLTIDQVFPYPSVLSEEQAQFLKELVGPVAR(F)      peptide count: 1
18614015(K)IFCSEAAWK(V)      peptide count: 15
18614015(K)IHNFGVIQEK(L)      peptide count: 40
18614015(K)ITAFVVER(S)      peptide count: 37
18614015(K)IWISNGGLADIFTVFAK(T)      peptide count: 80
18614015(K)KGIVNEQFLLQR(L)      peptide count: 13
18614015(K)MLCDSWCIEAATR(I)      peptide count: 2
18614015(K)NDALEKVEDDTLQGLK(E)      peptide count: 6
18614015(K)NPFGNVGLLMGEAGK(Q)      peptide count: 26
18614015(K)SFAVGMFK(G)      peptide count: 20
18614015(K)TPIKDAATGAVK(E)      peptide count: 28
18614015(K)VADECIQIMGGMGFMK(E)      peptide count: 5
18614015(K)VADECIQIMGGMGFMKEPGVER(V)      peptide count: 1
18614015(K)VAVNILNNGR(F)      peptide count: 46
18614015(K)VAVNILNNGRFGMAATLAGTMK(S)      peptide count: 1
18614015(K)VAVNILNNGRFGMAATLAGTMK(S)      peptide count: 2
18614015(K)VEDDTLQGLK(E)      peptide count: 31
18614015(K)VEDDTLQGLKELGAFGLQVPSELGGLGLSNTQYAR(L)      peptide count: 1
18614015(K)VPSENVLGEVGDGFK(V)      peptide count: 40
18614015(K)YYTLNGSK(I)      peptide count: 25
18614015(R)EATQAVLDKPETLSSDASTR(E)      peptide count: 55
18614015(R)EKPARAESKSFAVGMFK(G)      peptide count: 1
18614015(R)EKYLPR(V)      peptide count: 5
18614015(R)ENMASLQSSPQHQELFR(N)      peptide count: 29
18614015(R)FFEEVNDPAK(N)      peptide count: 21
18614015(R)FFEEVNDPAKNDALEK(V)      peptide count: 14
18614015(R)FFEEVNDPAKNDALEKVEDDTLQGLK(E)      peptide count: 12
18614015(R)FGMAATLAGTMK(S)      peptide count: 35
18614015(R)FGMAATLAGTMKSLIAK(A)      peptide count: 1
18614015(R)IFEGANDILR(L)      peptide count: 60
18614015(R)IRENMASLQSSPQHQELFR(N)      peptide count: 53
18614015(R)LADGAIDLYAMVVVLSR(A)      peptide count: 124
18614015(R)LAEIVGMHDLGVSVTLGAHQSIGFK(G)      peptide count: 23
18614015(R)LFVALQGCMDK(G)      peptide count: 12
18614015(R)MAILQYVTESMAYMLSANMDQGFK(D)      peptide count: 7
18614015(R)MAILQYVTESMAYMLSANMDQGFKDFQIEAAISK(I)      peptide count: 4
18614015(R)NFRSISKAMVENGGLVTGNPLGI(-)      peptide count: 12
18614015(R)RTGIGSGLSLSGIVHPELSR(S)      peptide count: 4
18614015(R)SFGGVTHGLPEK(K)      peptide count: 36
18614015(R)SFGGVTHGLPEKK(M)      peptide count: 43
18614015(R)SGELAVQALDQFATVVEAK(L)      peptide count: 422
18614015(R)SLSEGYPTAQHEK(M)      peptide count: 102
18614015(R)SSAIPSPCGK(Y)      peptide count: 17
18614015(R)TGIGSGLSLSGIVHPELSR(S)      peptide count: 43
18614015(R)TQFGDK(I)      peptide count: 13
18614015(R)TQFGDKIHNFGVIQEK(L)      peptide count: 9
18614015(R)VASGQALAAFCLTEPSSGSDVASIR(S)      peptide count: 8
15253431AGLGSGLSLSGLVHPELSR 2   Pept_E (Sonar search): 2.10E-03 
15253431AGLGSGLSLSGLVHPELSR 3   Pept_E (Sonar search): 4.80E-05 
15253431ALEQFATVVEAK 2    
15253431ALEQFATVVEAK 2   Pept_E (Sonar search): 6.00E-02 
15253431ALEQFATVVEAK 3   Pept_E (Sonar search): 1.90E-01 
15253431ASNTAEVFFDGVR 2   Pept_E (Sonar search): 8.00E-04 
15253431EGMAALQSDPWQQELYR 3   Pept_E (Sonar search): 9.90E-03 
15253431ELGAFGLQVPSELGGVGLCNTQYAR 3   Pept_E (Sonar search): 9.30E-03 
15253431ELSGLGSALK 2   Pept_E (Sonar search): 1.00E-02 
15253431ELVEPVSR 2   Pept_E (Sonar search): 1.00E+00 
15253431FFEEVNDPAK 2   Pept_E (Sonar search): 1.10E-03 
15253431FGMAAALAGTMR 2   Pept_E (Sonar search): 7.50E-04 
15253431GIVNEQFLLQR 2   Pept_E (Sonar search): 1.70E-03 
15253431GQLTTDQVFPYPSVLNEEQTQFLK 2    
15253431GQLTTDQVFPYPSVLNEEQTQFLK 3   Pept_E (Sonar search): 4.20E-02 
15253431IFEGTNDILR 2   Pept_E (Sonar search): 8.00E-02 
15253431IFGSEAAWK 2   Pept_E (Sonar search): 2.20E-01 
15253431IHNFGLIQEK 1   Pept_E (Sonar search): 5.30E-04 
15253431IHNFGLIQEK 2    
15253431ITAFVVER 2   Pept_E (Sonar search): 2.40E-01 
15253431LASGETVAAFCLTEPSSGSDAASIR 3   Pept_E (Sonar search): 4.40E-04 
15253431LFVALQGCMDK 2   Pept_E (Sonar search): 3.70E-03 
15253431LWISNGGLADIFTVFAK 2   Pept_E (Sonar search): 2.30E-03 
15253431LWISNGGLADIFTVFAK 2    
15253431NDALEMVEETTWQGLK 3   Pept_E (Sonar search): 7.00E-02 
15253431NPFGNAGLLLGEAGK 2   Pept_E (Sonar search): 1.60E-03 
15253431TPVTDPATGAVK 2   Pept_E (Sonar search): 2.60E-04 
15253431VPSENVLGEVGSGFK 2   Pept_E (Sonar search): 4.40E-05 
15253431YYTLNGSKLWISNGGLADIFTVFAK 3    
21616181ELGAFGLQVPSELGGLGLSNTQYAR2721.43833 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181GIVNEQFLLQR1460.83672 (observed)   N-Term(iTRAQ4plex)peptide count: 8
21616181GIVNEQFLLQR1460.83452 (observed)   N-Term(iTRAQ4plex)peptide count: 3
21616181NPFGNVGLLMGEAGK1791.97759 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 3
21616181SGELAVQALDQFATVVEAK2264.24137 (observed)   N-Term(iTRAQ4plex), K19(iTRAQ4plex)peptide count: 2
21616181VAVNILNNGR1214.69658 (observed)   N-Term(iTRAQ4plex), N8(Deamidated)peptide count: 2
21616181VAVNILNNGR1214.70012 (observed)   N-Term(iTRAQ4plex), N8(Deamidated) peptide count: 1
21616181VPSENVLGEVGDGFK1834.98174 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 3
21127740IFEGTNDILRLFVALQGCMDK814.41 (observed)33.54E+0635.85 (HPLC [min or %B])Deamidation (NQ)MS2 score: 28.97
21127740IFEGTNDILRLFVALQGCMDK814.41 (observed)39.25E+0529.09 (HPLC [min or %B])Deamidation (NQ)MS2 score: 28.96
21127740IFEGTNDILRLFVALQGCMDK814.74 (observed)33.68E+0637.2 (HPLC [min or %B])2 Deamidation (NQ)MS2 score: 26.51
21127740ALEQFATVVEAK653.36 (observed)23.09E+0524.48 (HPLC [min or %B]) MS2 score: 49.73
21127740GILLFGTK424.77 (observed)27.50E+0527.16 (HPLC [min or %B]) MS2 score: 22.04
21127740IFEGTNDILRLFVALQGCMDK814.41 (observed)31.75E+0629.19 (HPLC [min or %B])Deamidation (NQ)MS2 score: 26.42
21127740IFEGTNDILRLFVALQGCMDK814.42 (observed)32.16E+0631.58 (HPLC [min or %B])Deamidation (NQ)MS2 score: 26.36
18563753ALEQFATVVEAJ3    
18563753AMVENGGLVTSNPLRV2    
18563753AMVENGGLVTSNPLRV3    
18563753AMVENGGLVTSNPLRV3    
18563753ELVGPVAR2    
18563753GIVNEQFLLQR3    
18563753GIVNEQFLLQR2    
18563753GIVNEQFLLQR3    
18563753GIVNEQFLLQR2    
18563753GIVNEQFLLQR2    
18563753GIVNEQFLLQR2    
18563753GJELTGLGNALJ3    
18563753GJELTGLGNALJ3    
18563753GQLTTDQVFPYPSVLNEEQTQFLJ3    
18563753GQLTTDQVFPYPSVLNEEQTQFLJ4    
18563753GQLTTDQVFPYPSVLNEEQTQFLJ3    
18563753GQLTTDQVFPYPSVLNEEQTQFLJ4    
18563753GQLTTDQVFPYPSVLNEEQTQFLJ4    
18563753IFEGTNDILR2    
18563753IFEGTNDILR2    
18563753IHNFGVIQEJ3    
18563753IHNFGVIQEJ3    
18563753ITAFVVER2    
18563753ITAFVVER2    
18563753ITAFVVER2    
18563753ITAFVVER2    
18563753IWISNGGLADIFTVFAJ3    
18563753NPLGNVGLLIGEASJ3    
18563753NPLGNVGLLIGEASJ3    
18563753SFAVGMFJ2    
18563753SFAVGMFJ2    
18563753SFGGVTHGLPEJJ4    
18563753SLSEGYPTAQHEJ3    
18563753SLSEGYPTAQHEJ3    
18563753SLSEGYPTAQHEJ3    
18563753TGIGSGLSLSGIVHPELSR3    
18563753TGIGSGLSLSGIVHPELSR3    
18563753TGIGSGLSLSGIVHPELSR3    
18563753TPIJDAATGAVJ3    
18563753TQFGDJIHNFGVIQEJ4    
18563753TQFGDJIHNFGVIQEJ4    
18563753TQFGDJIHNFGVIQEJ4    
18563753VAVNILNNGR2    
18563753VAVNILNNGR2    
18563753VAVNILNNGR2    
18563753VAVNILNNGR2    
18563753VPAENVLGEVGDGFJ3    
18563753YYTLNGSJ2    

Compile date 12-23-2014© PADB initiative