PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5656ACADSAcyl-CoA dehydrogenase, short-chain specific, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KELVPIAAQLDREHLFPTAQVKK 3    
18501002KELVPIAAQLDREHLFPTAQVKKM 3    
18501002KGISAFLVPM*PTPGLTLGKK 2    
18501002KLADMALALESARL 2    
18501002RLHTVYQSVELPETHQM*LRQ 3    
18501002RLHTVYQSVELPETHQMLRQ 3    
18501002RLHTVYQSVELPETHQMLRQ 2    
18614015(K)AWITNSWEASATVVFASTDR(S)      peptide count: 4
18614015(K)DFAEK(G)      peptide count: 2
18614015(K)DNKKPFTK(E)      peptide count: 29
18614015(K)EDKLGIR(A)      peptide count: 1
18614015(K)ELVPIAAQLDR(E)      peptide count: 19
18614015(K)ELVPIAAQLDREHLFPTAQVK(K)      peptide count: 11
18614015(K)ENLLGEPGMGFK(I)      peptide count: 13
18614015(K)FGSAQQK(Q)      peptide count: 20
18614015(K)GISAFLVPMPTPGLTLGK(K)      peptide count: 36
18614015(K)IAMQTLDMGR(I)      peptide count: 44
18614015(K)IGCFALSEPGNGSDAGAASTTAR(E)      peptide count: 16
18614015(K)KEDKLGIR(A)      peptide count: 5
18614015(K)KMGELGLLAMDVPEELSGAGLDYLAYSIALEEISR(A)      peptide count: 5
18614015(K)KPFTK(E)      peptide count: 1
18614015(K)LAASEAATAISHQAIQILGGMGYVTEMPAER(Y)      peptide count: 35
18614015(K)LADMALALESAR(L)      peptide count: 37
18614015(K)LQNIQFK(L)      peptide count: 28
18614015(K)LQNIQFKLADMALALESARLLTWR(A)      peptide count: 2
18614015(K)QQWITPFTNGDK(I)      peptide count: 9
18614015(K)YAENR(N)      peptide count: 2
18614015(K)YAENRNAFGAPLTK(L)      peptide count: 1
18614015(R)AAMLKDNK(K)      peptide count: 3
18614015(R)AAMLKDNKKPFTK(E)      peptide count: 6
18614015(R)ACASTGVIMSVNNSLYLGPILK(F)      peptide count: 2
18614015(R)ACASTGVIMSVNNSLYLGPILK(F)      peptide count: 2
18614015(R)ASSTANLIFEDCR(I)      peptide count: 12
18614015(R)ASSTANLIFEDCRIPK(E)      peptide count: 1
18614015(R)DFAEK(E)      peptide count: 4
18614015(R)DFAEKELVPIAAQLDREHLFPTAQVK(K)      peptide count: 2
18614015(R)EEGDSWVLNGTK(A)      peptide count: 23
18614015(R)EHLFPTAQVK(K)      peptide count: 36
18614015(R)IGIASQALGIAQASLDCAVK(Y)      peptide count: 184
18614015(R)IGIASQALGIAQASLDCAVKYAENR(N)      peptide count: 4
18614015(R)ILTDAR(R)      peptide count: 7
18614015(R)ITEIYEGTSEIQR(L)      peptide count: 39
18614015(R)LHTVYQSVELPETHQMLR(Q)      peptide count: 35
18614015(R)LLTWR(A)      peptide count: 2
18614015(R)LVIAGHLLR(S)      peptide count: 51
18614015(R)NAFGAPLTK(L)      peptide count: 22
15253431IGIASQALGIAQTALDCAVNYAENR 3   Pept_E (Sonar search): 1.10E-06 
15253431ITEIYEGTSEIQR 2   MS2 score: 47 
21616181ASSTANLIFEDCR1616.75383 (observed)   N-Term(iTRAQ4plex), C12(Methylthio) peptide count: 1
18563753ASSTANLIFEDCRIPJ3    
18563753ASSTANLIFEDCRIPJ3    
18563753ASSTANLIFEDCRIPJ3    
18563753EEGDSWVLNGTJ3    
18563753ENLLGEPGMGFJ3    
18563753GISAFLVPMPTPGLTLGJ3    
18563753GISAFLVPMPTPGLTLGJ3    
18563753HAFGAPLTJ3    
18563753ITEIYEGTSEIQR2    
18563753ITEIYEGTSEIQR3    
18563753LADMALALESAR2    
18563753LHTVYQSVELPETHQMLR4    
18563753LQNIQFJ2    
18563753LQNIQFJ2    
18563753LQNIQFJ2    
18563753LQNIQFJ2    
18563753LVIAGHLLR3    
18563753LVIAGHLLR3    
18563753LVIAGHLLR3    
18563753LVIAGHLLR3    

Compile date 12-23-2014© PADB initiative