PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5655ACADM, MCADAcyl-CoA dehydrogenase, medium-chain specific, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16948836AFAGDIANQLATDAVQILGGNGFNTEYPVEK0.7 (delta mass [ppm])3    
18501002KAAHKQEPGLGFSFELTEQQKE 3    
18501002KAAHKQEPGLGFSFELTEQQKEFQATARK 3    
18501002KAFAGDIANQLATDAVQIFGGYGFNTEYPVEKL 2    
18501002KAFAGDIANQLATDAVQIFGGYGFNTEYPVEKL 3    
18501002KAFTGFIVEADTPGIHIGKKE 2    
18501002KAFTGFIVEADTPGIHIGKKE 3    
18501002KANWYFLLARS 2    
18501002KENVLIGEGAGFKI 2    
18501002KIYQIYEGTAQIQRL 3    
18501002KIYQIYEGTAQIQRL 2    
18501002KSGEYPFPLIKR 2    
18501002KSGEYPFPLIKRA 2    
18501002RALDEATKYALDRK 3    
18501002REEIIPVAPEYDKS 2    
18501002REEIIPVAPEYDKSGEYPFPLIKR 2    
18501002RGIAFEDVRVPKE 2    
18501002RGIAFEDVRVPKENVLIGEGAGFKI 3    
18501002RM*TEQPM*M*CAYCVTEPSAGSDVAAIKT 2    
18501002RMTEQPM*M*CAYCVTEPSAGSDVAAIKTKA 3    
18501002RMTEQPMMCAYCVTEPSAGSDVAAIKT 2    
18501002RMTEQPMMCAYCVTEPSAGSDVAAIKT 3    
18501002RMTEQPMMCAYCVTEPSAGSDVAAIKTKA 3    
18501002RMTEQPMMCAYCVTEPSAGSDVAAIKTKA 2    
18501002RTRPTVAAGAVGLAQRA 3    
18501002RTRPTVAAGAVGLAQRA 2    
18501002RVPKENVLIGEGAGFKI 2    
18501002RVPKENVLIGEGAGFKI 3    
16948836TRPVVAAGAVGLAQR2.1 (delta mass [ppm])3    
16684767KVELARM587.6917 (observed)1   peptide count: 1
18614015(K)AAHKQEPGLGFSFELTEQQKEFQATAR(K)      peptide count: 1
18614015(K)AFAGDIANQLATDAVQIFGGYGFNTEYPVEK(L)      peptide count: 176
18614015(K)AFTGFIVEADTPGIHIGK(K)      peptide count: 15
18614015(K)AFTGFIVEADTPGIHIGKK(E)      peptide count: 3
18614015(K)ANWYFLLAR(S)      peptide count: 38
18614015(K)EFQATAR(K)      peptide count: 52
18614015(K)ELNMGQR(C)      peptide count: 14
18614015(K)ENVLIGEGAGFK(I)      peptide count: 46
18614015(K)FAREEIIPVAPEYDK(S)      peptide count: 1
18614015(K)IAMGAFDR(T)      peptide count: 23
18614015(K)IYQIYEGTAQIQR(L)      peptide count: 26
18614015(K)KELNMGQR(C)      peptide count: 1
18614015(K)KGDEYVINGQK(M)      peptide count: 57
18614015(K)KYLGR(M)      peptide count: 4
18614015(K)LLVEHQGVSFLLAEMAMK(V)      peptide count: 10
18614015(K)MWITNGGK(A)      peptide count: 11
18614015(K)QEPGLGFSFELTEQQK(E)      peptide count: 5
18614015(K)SGEYPFPLIK(R)      peptide count: 35
18614015(K)YALDR(K)      peptide count: 24
18614015(K)YALDRK(T)      peptide count: 32
18614015(R)AAWEVDSGR(R)      peptide count: 11
18614015(R)AAWEVDSGRR(N)      peptide count: 32
18614015(R)ALDEATK(Y)      peptide count: 18
18614015(R)EEIIPVAPEYDK(S)      peptide count: 42
18614015(R)EEIIPVAPEYDKSGEYPFPLIK(R)      peptide count: 11
18614015(R)EHIEK(Y)      peptide count: 4
18614015(R)GIAFEDVR(V)      peptide count: 53
18614015(R)GIAFEDVRVPK(E)      peptide count: 7
18614015(R)LSYQR(A)      peptide count: 6
18614015(R)LSYQR(A)      peptide count: 2
18614015(R)NTYYASIAK(A)      peptide count: 15
18614015(R)RNTYYASIAK(A)      peptide count: 4
18614015(R)SNPDPKVPASK(A)      peptide count: 1
18614015(R)TRPTVAAGAVGLAQR(A)      peptide count: 98
15253431AFAGDIANQLATDAVQILGGNGFNTEYPVEK 3    
15253431AFTGFIVEADTPGIQIGR 2   Pept_E (Sonar search): 1.50E-02 
15253431AFTGFIVEADTPGIQIGR 3   Pept_E (Sonar search): 2.90E-02 
15253431EEIIPVAAEYDK 2   Pept_E (Sonar search): 1.00E-01 
15253431ENVLIGDGAGFK 2   Pept_E (Sonar search): 2.20E-03 
15253431GIVFEDVK 2   Pept_E (Sonar search): 9.00E-02 
15253431IYQIYEGTSQIQR 2   Pept_E (Sonar search): 1.70E-02 
15253431IYQIYEGTSQIQR 3    
15253431TGEYPVPLIR 2   Pept_E (Sonar search): 8.50E-04 
15253431TRPVVAAGAVGLAQR 3   Pept_E (Sonar search): 1.20E-04 
21616181ANWYFLLAR1297.72344 (observed)   N-Term(iTRAQ4plex) peptide count: 1
21616181EEIIPVAPEYDK1690.91863 (observed)   N-Term(iTRAQ4plex), K12(iTRAQ4plex)peptide count: 3
21616181EEIIPVAPEYDK1690.91496 (observed)   N-Term(iTRAQ4plex), K12(iTRAQ4plex)MS2 score: 52peptide count: 7
21616181GIAFEDVR1050.57109 (observed)   N-Term(iTRAQ4plex) peptide count: 2
21616181IYQIYEGTAQIQR1726.92827 (observed)   N-Term(iTRAQ4plex)peptide count: 8
21616181IYQIYEGTAQIQR1726.92583 (observed)   N-Term(iTRAQ4plex)peptide count: 5
21127740ANWYFLLAR577.31 (observed)26.84E+0539.08 (HPLC [min or %B]) MS2 score: 41.52
21127740ANWYFLLAR577.31 (observed)23.00E+0543.55 (HPLC [min or %B]) MS2 score: 44.96
18563753AFTGFIVEADTPGIHIGJJ4    
18563753AFTGFIVEADTPGIHIGJJ4    
18563753AFTGFIVEADTPGIHIGJJ4    
18563753AFTGFIVEADTPGIHIGJJ4    
23376485AFTGFIVEADTPGIQIGR946.506 (observed)   :::::::::::::::::::
23376485ANWYFLLAR577.315 (observed)   ::::::::::
18563753ANWYFVLTR2    
18563753ANWYFVLTR2    
23376485EEIIPVAAEYDK688.853 (observed)   :::::::::::::
23376485EEIIPVAAEYDK688.853 (observed)   :::::::::::::
23376485EEIIPVAAEYDK688.854 (observed)   :::::::::::::
23376485EEIIPVAAEYDK688.853 (observed)   :::::::::::::
18563753EEIIPVAPDYDJ3    
18563753EEIIPVAPDYDJ2    
18563753EEIIPVAPDYDJ3    
18563753EEIIPVAPDYDJ2    
18563753EEIIPVAPDYDJ3    
18563753EEIIPVAPDYDJ3    
23376485ENVLIGDGAGFK610.322 (observed)   :::::::::::::
23376485ENVLIGDGAGFK610.323 (observed)   :::::::::::::
18563753ENVLIGEGAGFJ3    
18563753ENVLIGEGAGFJ3    
18563753ENVLIGEGAGFJ3    
18563753GITFEDVR2    
18563753GITFEDVR2    
18563753GITFEDVR2    
18563753GITFEDVRVPJ3    
23376485GIVFEDVKVPK615.861 (observed)   ::::::::::::
23376485IYQIYEGTSQIQR799.909 (observed)   ::::::::::::::
23376485IYQIYEGTSQIQR799.915 (observed)   ::::::::::::::
18563753JGDEYVINGQJ3    
18563753JGDEYVINGQJ3    
18563753SGEYPFPLIJ3    
18563753SGEYPFPLIJ2    
18563753SGEYPFPLIJ2    
18563753SGEYPFPLIJ3    
18563753SGEYPFPLIJ2    
18563753SGEYPFPLIJR3    
18563753SGEYPFPLIJR3    
18563753TRPTVAAGAVGLAQR3    
18563753TRPTVAAGAVGLAQR3    
18563753TRPTVAAGAVGLAQR3    
23376485TRPVVAAGAVGLAQR733.435 (observed)   ::::::::::::::::

Compile date 12-23-2014© PADB initiative