PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5653ACAD9Acyl-CoA dehydrogenase family member 9, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KGVFPFPEVSQHELSEINQFVGPLEKF 3    
18501002RKIDQEGKIPVDTLEKL 3    
18614015(K)DYPYER(M)      peptide count: 1
18614015(K)ELFLGNIEQK(G)      peptide count: 6
18614015(K)ELKSGNVTTVMETIGRK(L)      peptide count: 1
18614015(K)ELKSGNVTTVMETIGRK(L)      peptide count: 2
18614015(K)FALMAQK(A)      peptide count: 20
18614015(K)FFTEEVDSR(K)      peptide count: 27
18614015(K)GIILVGNEEQK(A)      peptide count: 26
18614015(K)GVFPFPEVSQHELSEINQFVGPLEK(F)      peptide count: 28
18614015(K)IDQEGKIPVDTLEK(L)      peptide count: 2
18614015(K)IPVDTLEK(L)      peptide count: 5
18614015(K)KLIELTAEYACTR(K)      peptide count: 1
18614015(K)LEENVHYFGR(T)      peptide count: 18
18614015(K)LIELTAEYACTR(K)      peptide count: 2
18614015(K)LRDSLGR(T)      peptide count: 7
18614015(K)LSSGEHIAAFCLTEPASGSDAASIQTR(A)      peptide count: 1
18614015(K)MTAFIVER(D)      peptide count: 10
18614015(K)NAPENLDEQIK(K)      peptide count: 5
18614015(K)NAPENLDEQIKK(V)      peptide count: 23
18614015(K)NIVEEQLVLK(R)      peptide count: 13
18614015(K)NIVEEQLVLKR(V)      peptide count: 7
18614015(K)RAYICAHPLDR(A)      peptide count: 4
18614015(K)RVANILINLYGMTAVLSR(A)      peptide count: 1
18614015(K)SGNVTTVMETIGR(K)      peptide count: 22
18614015(K)SLGLFGIQVPEEYGGLGLSNTMYAR(L)      peptide count: 14
18614015(K)TDKMTAFIVER(D)      peptide count: 3
18614015(K)TEVVDSDGSK(T)      peptide count: 12
18614015(K)TEVVDSDGSKTDK(M)      peptide count: 2
18614015(K)VAMNILNSGR(F)      peptide count: 22
18614015(K)VFSSEAAWQCVSEALQILGGSGYMK(D)      peptide count: 32
18614015(K)VFSSEAAWQCVSEALQILGGSGYMKDYPYER(M)      peptide count: 2
18614015(K)VWITNGGLANIFTVFAK(T)      peptide count: 21
18614015(K)YFILNGSK(V)      peptide count: 26
18614015(R)ATLSEDKK(Y)      peptide count: 15
18614015(R)AYICAHPLDR(A)      peptide count: 27
18614015(R)DFGGITNGKPEDK(L)      peptide count: 33
18614015(R)FSMGSAVAGMLK(K)      peptide count: 10
18614015(R)FSMGSAVAGMLKK(L)      peptide count: 1
18614015(R)GSNTCEVHFENTR(V)      peptide count: 13
18614015(R)ILLIFEGTNEILR(L)      peptide count: 36
18614015(R)ILLIFEGTNEILRLFIALTGLQHAGR(I)      peptide count: 3
18614015(R)KIDQEGK(I)      peptide count: 4
18614015(R)KIDQEGKIPVDTLEK(L)      peptide count: 14
18614015(R)LFIALTGLQHAGR(I)      peptide count: 5
18614015(R)LGEIISLDASITVTLAAHQAIGLK(G)      peptide count: 9
18614015(R)NLSEFGLIQEK(F)      peptide count: 4
18614015(R)TVDLGLTGDLGVVHPSLGDSANK(L)      peptide count: 2
18614015(R)TVDLGLTGDLGVVHPSLGDSANKLEENVHYFGR(T)      peptide count: 6
18614015(R)TVETLLLR(F)      peptide count: 21
18614015(R)VANILINLYGMTAVLSR(A)      peptide count: 7
18614015(R)VPVENVLGEVGGGFK(V)      peptide count: 31
15253431FFTEEVDSR 2   Pept_E (Sonar search): 2.00E-02 
21616181VPVENVLGEVGGGFK1789.00888 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 2
21616181VPVENVLGEVGGGFK1789.00943 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 6
23308193GIILAGTEEQKAK     MS2 score: 56,000peptide count: 4
23308193IPVENILGEVGDGFK     MS2 score: 56,000peptide count: 4
23308193TIMEEQLVLK     MS2 score: 56,000peptide count: 4
23308193VSQQILEK     MS2 score: 56,000peptide count: 4

Compile date 12-23-2014© PADB initiative