PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5644ABHD11, WBSCR21, PP1226Abhydrolase domain-containing protein 11

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)AVEIPEK(V)      peptide count: 1
18614015(K)AVEIPEKVPHSQAR(K)      peptide count: 5
18614015(K)IMTFPQQR(E)      peptide count: 1
18614015(K)QLSSVVK(E)      peptide count: 9
18614015(K)TAMLLALQRPDVVER(L)      peptide count: 11
18614015(K)TNFNSLAK(A)      peptide count: 3
18614015(K)VPHSQAR(K)      peptide count: 4
18614015(R)AVELPEK(Q)      peptide count: 3
18614015(R)EPYSGPTLFLLGGNSTYVQPSHHSEIR(R)      peptide count: 7
18614015(R)LFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA(-)      peptide count: 1
18614015(R)LNLDTLAQHLDK(I)      peptide count: 11
18614015(R)LVVVDISPVGTTPGSHIGAFIAAMK(A)      peptide count: 5
18614015(R)QFLLTNLVEVGGR(F)      peptide count: 16
18614015(R)VLTVDAR(N)      peptide count: 10
15253431LLDGEAALPAVVFLHGLFGSK 2    

Compile date 12-23-2014© PADB initiative