PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5634AASS, LKR/SDHAlpha-aminoadipate semialdehyde synthase, mitochondrial

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KKYNINPVSLTVGKQ 2    
18501002KKYNINPVSLTVGKQEAKL 3    
18501002KLGGDNTQLEAAEWLGLLGDEQVPQAESIVDAFSKH 3    
18501002KLQSLVESQDLVISLLPYVLHPVVAKA 3    
18501002KMLLDGEIEAKG 2    
18501002KSIGPLTFVFTGTGNVSKG 2    
18501002RDAVITSNGLLTDKYKY 2    
18501002RDNNIEITLGSDMTNQMQQLSKK 2    
18501002RDSFGIRHPSGHLENKT 3    
18501002RKTDGVYDPVEYEKYPERY 3    
18501002RVNMVTASYITPAMKELEKS 3    
18614015(K)ACIESR(V)      peptide count: 2
18614015(K)ACLSR(F)      peptide count: 1
18614015(K)AEGIVFNTQSTIK(L)      peptide count: 2
18614015(K)AEGIVFNTQSTIKL(-)      peptide count: 2
18614015(K)ALNGFVK(L)      peptide count: 3
18614015(K)AQEANMNLLDEVLK(Q)      peptide count: 4
18614015(K)AQEANMNLLDEVLKQEIR(L)      peptide count: 3
18614015(K)DMIVMR(D)      peptide count: 5
18614015(K)EIYGPILER(I)      peptide count: 17
18614015(K)EVVFTK(L)      peptide count: 6
18614015(K)FSWSPVGVLMNIMQPASYLLNGK(V)      peptide count: 27
18614015(K)GAQEVFNELPCEYVEPHELR(E)      peptide count: 3
18614015(K)GLMGPFTK(E)      peptide count: 5
18614015(K)KTYAFFSHTIK(A)      peptide count: 7
18614015(K)KYNINPVSLTVGK(Q)      peptide count: 12
18614015(K)KYNINPVSLTVGKQEAK(L)      peptide count: 2
18614015(K)LGGDNTQLEAAEWLGLLGDEQVPQAESIVDAFSK(H)      peptide count: 12
18614015(K)LGLINR(E)      peptide count: 13
18614015(K)LKEVVFTK(L)      peptide count: 12
18614015(K)LMSKKTYAFFSHTIK(A)      peptide count: 2
18614015(K)LQSLVESQDLVISLLPYVLHPVVAK(A)      peptide count: 51
18614015(K)LRESR(E)      peptide count: 1
18614015(K)LSYGPEEKDMIVMR(D)      peptide count: 2
18614015(K)MLLDGEIEAK(G)      peptide count: 10
18614015(K)MVDHR(G)      peptide count: 1
18614015(K)QLLCDLVGISR(S)      peptide count: 14
18614015(K)RPPEEK(L)      peptide count: 5
18614015(K)SIGPLTFVFTGTGNVSK(G)      peptide count: 19
18614015(K)SSVVPVEGCPELPHK(L)      peptide count: 6
18614015(K)SVDDAGITVIGELGLDPGLDHMLAMETIDTAK(E)      peptide count: 2
18614015(K)SVDDAGITVIGELGLDPGLDHMLAMETIDTAK(E)      peptide count: 2
18614015(K)TDGVYDPVEYEKYPER(Y)      peptide count: 4
18614015(K)TGDLRK(V)      peptide count: 2
18614015(K)TIDLVVYGDFNGFSAMAK(T)      peptide count: 3
18614015(K)TVGLPTAMAAK(M)      peptide count: 5
18614015(K)TYAFFSHTIK(A)      peptide count: 5
18614015(K)VLIQPSNR(R)      peptide count: 6
18614015(K)VLIQPSNRR(A)      peptide count: 8
18614015(K)VLVLGSGYVSGPVLEYLSR(D)      peptide count: 15
18614015(K)VVNVTGGVSFLNSVTPMDYFPGLNLEGYPNR(D)      peptide count: 3
18614015(K)VYGTVLSR(H)      peptide count: 15
18614015(K)YAEIYGISSAHTLLR(G)      peptide count: 7
18614015(K)YNINPVSLTVGK(Q)      peptide count: 4
18614015(K)YNINPVSLTVGKQEAK(L)      peptide count: 1
18614015(R)AGGILQEDITEACLILGVK(R)      peptide count: 33
18614015(R)AIHDKEYVR(A)      peptide count: 35
18614015(R)DAGYEISLGLMPK(S)      peptide count: 5
18614015(R)DAVITSNGLLTDK(Y)      peptide count: 4
18614015(R)DAVITSNGLLTDKYK(Y)      peptide count: 12
18614015(R)DNNIEITLGSDMTNQMQQLSK(K)      peptide count: 1
18614015(R)DSFGIR(H)      peptide count: 2
18614015(R)DSFGIR(H)      peptide count: 2
18614015(R)EAYPALRPEANPLTWK(Q)      peptide count: 5
18614015(R)EAYPALRPEANPLTWKQLLCDLVGISR(S)      peptide count: 6
18614015(R)EDVNAWER(R)      peptide count: 8
18614015(R)ERIQFLSMSTK(K)      peptide count: 2
18614015(R)FNTDIAPYTTCLINGIYWEQNTPR(L)      peptide count: 1
18614015(R)GLHHKPVMALR(R)      peptide count: 7
18614015(R)HHHLVR(K)      peptide count: 8
18614015(R)HPSGHLENK(T)      peptide count: 22
18614015(R)IKAEGIVFNTQSTIK(L)      peptide count: 3
18614015(R)IKAEGIVFNTQSTIKL(-)      peptide count: 1
18614015(R)IQFLSMSTK(K)      peptide count: 7
18614015(R)IVAFGQWAGVAGMINILHGMGLR(L)      peptide count: 21
18614015(R)IVAFGQWAGVAGMINILHGMGLR(L)      peptide count: 2
18614015(R)KTDGVYDPVEYEK(Y)      peptide count: 3
18614015(R)KTDGVYDPVEYEKYPER(Y)      peptide count: 10
18614015(R)KVYGTVLSR(H)      peptide count: 4
18614015(R)LIDYEK(M)      peptide count: 3
18614015(R)LLALGHHTPFMHLGMAHNYR(N)      peptide count: 4
18614015(R)NSSQAVQAVR(D)      peptide count: 51
18614015(R)QDAQSLLVPVK(S)      peptide count: 11
18614015(R)RAIHDK(E)      peptide count: 1
18614015(R)RAIHDKEYVR(A)      peptide count: 5
18614015(R)RAPLAPK(H)      peptide count: 25
18614015(R)REDVNAWER(R)      peptide count: 3
18614015(R)VNMVTASYITPAMK(E)      peptide count: 3
18614015(R)YKGYSK(A)      peptide count: 1
21127740TVGLPTAMAAKMLLDGEIGAK701.71 (observed)33.48E+0532.16 (HPLC [min or %B])Oxidation (M)MS2 score: 29.63

Compile date 12-23-2014© PADB initiative