PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A5630AADAC, DACArylacetamide deacetylase

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KVQALIYPALQALDTNVPSQQEGSHFPVLTRS 3    
18501002RWFLQEDVLEKY 2    
18614015(K)NPTPGSSELAQK(Y)      peptide count: 1
18614015(K)YGVDPR(R)      peptide count: 1
18614015(K)YPGFIDVK(A)      peptide count: 1
18614015(R)FWSEYFTTDR(G)      peptide count: 1
18614015(R)IYIPK(R)      peptide count: 1
18614015(R)WFLQEDVLEK(Y)      peptide count: 1

Compile date 12-23-2014© PADB initiative