PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A4552ACTG1, ACTGActin, cytoplasmic 2

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
15020595A.PEEHPVLLTEAPLNPK.A       
16901338AGFAGDDAPR-1.04 (delta mass [ppm])2   MS2 score: 52 
16901338AGFAGDDAPR2   MS2 score: 47 
16948836AGFAGDDAPR1 (delta mass [ppm])2    
16948836AGFAGDDAPR0.8 (delta mass [ppm])2    
16901338AVFPSIVGR2   MS2 score: 36 
16948836AVFPSIVGR0.7 (delta mass [ppm])2    
16948836AVFPSIVGR0.9 (delta mass [ppm])2    
17902193AVFPSIVGRPR       
16901338AVFPSIVGRPR-0.74 (delta mass [ppm])2   MS2 score: 27 
16901338AVFPSIVGRPR2   MS2 score: 41 
16948836AVFPSIVGRPR2.6 (delta mass [ppm])2    
16948836AVFPSIVGRPR0.6 (delta mass [ppm])2    
16901338CDVDIRK2   MS2 score: 33 
16901338CPEALFQPSFLGMESCGIHETTFNSIMK4  2Met(ox)MS2 score: 34 
16901338DLTDYLMK0.22 (delta mass [ppm])2  1Met(ox)MS2 score: 23 
16901338DLTDYLMK2   MS2 score: 42 
16948836DLTDYLMK1.3 (delta mass [ppm])2    
16948836DLTDYLMK2.4 (delta mass [ppm])1    
16901338DLYANTVLSGGTTMYPGIADR0.25 (delta mass [ppm])3  1Met(ox)MS2 score: 56 
16901338DLYANTVLSGGTTMYPGIADR2  1Met(ox)MS2 score: 106 
16948836DLYANTVLSGGTTMYPGIADR2.1 (delta mass [ppm])2    
16948836DLYANTVLSGGTTMYPGIADR2 (delta mass [ppm])2    
15852343DSYVGDEAQSK       
16901338DSYVGDEAQSK2   MS2 score: 52 
16948836DSYVGDEAQSK0.2 (delta mass [ppm])2    
16901338DSYVGDEAQSKR2   MS2 score: 59 
16948836DSYVGDEAQSKR0.8 (delta mass [ppm])2    
16901338EEEIAALVIDNGSGMCK-1.99 (delta mass [ppm])2  1Met(ox)MS2 score: 68 
16901338EEEIAALVIDNGSGMCK2  1Met(ox)MS2 score: 106 
16948836EEEIAALVIDNGSGMCK0.6 (delta mass [ppm])2    
16948836EEEIAALVIDNGSGMCK2 (delta mass [ppm])2    
16948836EEEIAALVIDNGSGMCK0.7 (delta mass [ppm])2    
16948836EEEIAALVIDNGSGMCK2.9 (delta mass [ppm])2    
17381150EEEIAALVIDNGSGMCKA   1Met-ox;AcetN  
15852343EITALAPSTMK       
16901338EITALAPSTMK-2.01 (delta mass [ppm])2  1Met(ox)MS2 score: 22 
16901338EITALAPSTMK2   MS2 score: 44 
16948836EITALAPSTMK0.1 (delta mass [ppm])1    
16948836EITALAPSTMK1.2 (delta mass [ppm])2    
16948836EVQLVESGGGLVQPGGSLR2.4 (delta mass [ppm])2    
16901338GYSFTTTAER-0.23 (delta mass [ppm])2   MS2 score: 58 
16901338GYSFTTTAER2   MS2 score: 62 
16948836GYSFTTTAER0.2 (delta mass [ppm])2    
16948836GYSFTTTAER2.5 (delta mass [ppm])2    
17902193GYSFTTTAEREIVR       
16901338HQGVMVGMGQK1.10 (delta mass [ppm])2   MS2 score: 43 
16901338HQGVMVGMGQK2   MS2 score: 61 
16948836HQGVMVGMGQK0.9 (delta mass [ppm])2    
16901338IIAPPER2   MS2 score: 26 
16948836IIAPPER0.2 (delta mass [ppm])2    
16948836IIAPPER1.3 (delta mass [ppm])2    
16901338IIAPPERK2   MS2 score: 40 
16948836IIAPPERK0.4 (delta mass [ppm])2    
16948836IIAPPERK1.1 (delta mass [ppm])2    
16901338IWHHTFYNELR-2.42 (delta mass [ppm])2   MS2 score: 48 
16901338IWHHTFYNELR3   MS2 score: 51 
16948836IWHHTFYNELR1.9 (delta mass [ppm])2    
16948836IWHHTFYNELR0.3 (delta mass [ppm])2    
15020595K.EITALAPSTMK.I       
15020595K.IWHHTFYNELR.V       
15020595K.SYELPDGQVITIGNER.F       
17381150KAGFAGDDAPRA      
17381150KCDVDIRK      
16901338KDLYANTVLSGGTTMYPGIADR0.55 (delta mass [ppm])3  1Met(ox)MS2 score: 79 
16901338KDLYANTVLSGGTTMYPGIADR3   MS2 score: 66 
16948836KDLYANTVLSGGTTMYPGIADR1.6 (delta mass [ppm])3    
16948836KDLYANTVLSGGTTMYPGIADR2.8 (delta mass [ppm])3    
17381150KDLYANTVLSGGTTMYPGIADRM   1Met-ox  
17381150KIIAPPERK      
17381150KLCYVALDFEQEMATAASSSSLEKS   1Met-ox  
17381150KQEYDESGPSIVHRK   pyroGlu  
17381150KQEYDESGPSIVHRK      
17381150KSYELPDGQVITIGNERF      
16901338LCYVALDFEQEMATAASSSSLEK2  1Met(ox)MS2 score: 142 
17902193LDLAGRDLTDYLMK    Oxidation (M)  
16901338LDLAGRDLTDYLMK-1.27 (delta mass [ppm])2  1Met(ox)MS2 score: 32 
15020595N.TVLSGGTTM#YPGLADR.M       
17902193QEYDESGPSIVHR       
16901338QEYDESGPSIVHR2   MS2 score: 60 
16948836QEYDESGPSIVHR1.6 (delta mass [ppm])2    
16948836QEYDESGPSIVHR1.6 (delta mass [ppm])2    
16901338QEYDESGPSIVHRK3   MS2 score: 25 
15020595R.GYSFTTTAER.E       
15020595R.TTGIVM#DSGDGVTHTVPIYEGYALPH.A       
15020595R.VAPEEHPVLLTEAPLNPK.A       
17381150RAVFPSIVGRPRH      
17381150RDLTDYLMKI   1Met-ox  
16948836RGILTLK0.3 (delta mass [ppm])2    
17381150RGYSFTTTAERE      
17381150RHQGVMVGMGQKD   2Met-ox  
17381150RKDLYANTVLSGGTTMYPGIADRM   1Met-ox  
17381150RLDLAGRD      
17381150RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL   1Met-ox  
17381150RVAPEEHPVLLTEAPLNPKA      
17902193SYELPDGQVITIGNER       
15852343SYELPDGQVITIGNER       
16901338SYELPDGQVITIGNER-1.98 (delta mass [ppm])2   MS2 score: 86 
16901338SYELPDGQVITIGNER2   MS2 score: 87 
16948836SYELPDGQVITIGNER1.5 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER2.3 (delta mass [ppm])2    
16901338TTGIVMDSGDGVTHTVPIYEGYALPHAILR3  1Met(ox)MS2 score: 44 
16948836TTGIVMDSGDGVTHTVPIYEGYALPHAILR2.6 (delta mass [ppm])4    
16948836TTGIVMDSGDGVTHTVPIYEGYALPHAILR1.7 (delta mass [ppm])3    
15852343VAPEEHPVLLTEALNPK       
17902193VAPEEHPVLLTEAPLNPK       
16901338VAPEEHPVLLTEAPLNPK-0.12 (delta mass [ppm])3   MS2 score: 44 
16901338VAPEEHPVLLTEAPLNPK2   MS2 score: 50 
16948836VAPEEHPVLLTEAPLNPK1.8 (delta mass [ppm])2    
16948836VAPEEHPVLLTEAPLNPK2.7 (delta mass [ppm])2    
16684767RSFYFVIVGHHDKPVFEMEFLPAGKAESKD 3    
16684767VEEEIAALVIDNGSCM*CKA 2    
18361515A.PEEHPVLLTEAPLNPK.A892.46 (observed)2    
18361515D.GQVITIGNER.F543.3 (observed)2    
18361515D.GVTHTVPIYEGYALPHAILR.L735.88 (observed)3    
18361515D.GVTHTVPIYEGYALPHAILR.L1104.03 (observed)2    
18361515D.GVTHTVPIYEGYALPHAILR.L736.28 (observed)3    
18361515D.LYANTVLSGGTTMYPGIADR.M1049.95 (observed)2    
18361515E.GYALPHAILR.L555.19 (observed)2    
18361515E.HPVLLTEAPLNPK.A714.47 (observed)2    
18361515E.HPVLLTEAPLNPK.A714.78 (observed)2    
18361515E.LPDGQVITIGNER.F1411.75 (observed)1    
18361515G.YALPHAILR.L526.79 (observed)2    
18361515I.AALVIDNGSGMCK.A1335.64 (observed)1    
18361515K.AGFAGDDAPR.A976.45 (observed)1    
18361515K.AGFAGDDAPR.A488.73 (observed)2    
18361515K.AGFAGDDAPR.A488.54 (observed)2    
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPRAVFPSIVGRPR.H719.64 (observed)3    
18361515K.DLYANTVLSGGTTMYPGIADR.M1107.73 (observed)2    
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.04 (observed)2    
18361515K.DSYVGDEAQSK.R599.8 (observed)2    
18361515K.DSYVGDEAQSK.R1200.53 (observed)1    
18361515K.DSYVGDEAQSK.R1198.38 (observed)1    
18361515K.DSYVGDEAQSK.R600.21 (observed)2    
18361515K.EITALAPSTMK.I1162.54 (observed)1    
18361515K.EITALAPSTMK.I581.31 (observed)2    
18361515K.EITALAPSTMK.I581.01 (observed)2    
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EKLCYVALDFEQEMATAASSSSLEK.S937.08 (observed)3    
18361515K.IWHHTFYN.E1117.17 (observed)1    
18361515K.IWHHTFYNELR.V758.15 (observed)2    
18361515K.IWHHTFYNELR.V505.77 (observed)3    
18361515K.IWHHTFYNELR.V505.25 (observed)3    
18361515K.IWHHTFYNELR.V758.21 (observed)2    
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELRVAPEEHPVLLTEAPLNPK.A1151.34 (observed)3    
18361515K.LCYVALDFEQEMATAASSSSLEK.S1275.84 (observed)2    
18361515K.LCYVALDFEQEMATAASSSSLEK.S1275.09 (observed)2    
18361515K.LCYVALDFEQEMATAASSSSLEK.S850.39 (observed)3    
18361515K.QEYDESGPSIVHR.K759.14 (observed)2    
18361515K.QEYDESGPSIVHR.K759.24 (observed)2    
18361515K.QEYDESGPSIVHR.K506.18 (observed)3    
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.SYELPDGQVITIGNER.F896.95 (observed)2    
18361515K.SYELPDGQVITIGNER.F895.45 (observed)2    
18361515K.SYELPDGQVITIGNER.F1790.89 (observed)1    
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.YSVWIGGSILASLSTFQQMWISK.Q1301.67 (observed)2    
18361515L.PDGQVITIGNER.F649.34 (observed)2    
18361515L.PDGQVITIGNER.F1298.67 (observed)1    
18361515L.RVAPEEHPVLLTEAPLNPK.A703.72 (observed)3    
18361515L.RVAPEEHPVLLTEAPLNPK.A1055.59 (observed)2    
18361515M.DSGDGVTHTVPIYEGYALPHAILR.L861.94 (observed)3    
18361515N.TVLSGGTTMYPGIADR.M819.8 (observed)2    
18361515N.TVLSGGTTMYPGIADR.M820.15 (observed)2    
18361515N.VLSGGTTMYPGIADR.M769.53 (observed)2    
18361515N.VLSGGTTMYPGIADR.M768.65 (observed)2    
18361515P.PEEHPVLLTEAPLNPK.A891.98 (observed)2    
18361515R.AVFPSIVGR.P472.78 (observed)2    
18361515R.AVFPSIVGR.P945.55 (observed)1    
18361515R.AVFPSIVGR.P473.36 (observed)2    
18361515R.AVFPSIVGRPR.H599.65 (observed)2    
18361515R.AVFPSIVGRPR.H599.78 (observed)2    
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.CPEALFQPSFLGMESCGIHETTFNSIMK.C1078.09 (observed)3    
18361515R.CPEALFQPSFLGMESCGIHETTFNSIMK.C1078.28 (observed)3    
18361515R.DLTDYLMK.I999.49 (observed)1    
18361515R.DLTDYLMK.I499.85 (observed)2    
18361515R.DLTDYLMK.I498.82 (observed)2    
18361515R.DLTDYLMK.I998.49 (observed)1    
18361515R.GYSFTTTAER.E566.36 (observed)2    
18361515R.GYSFTTTAER.E566.92 (observed)2    
18361515R.GYSFTTTAER.E2   peptide delta score: 48.5 
18361515R.GYSFTTTAER.E2   peptide delta score: 45.55 
18361515R.HQGVMVGMGQK.D586 (observed)2    
18361515R.HQGVMVGMGQK.D1173.56 (observed)1    
18361515R.HQGVMVGMGQK.D585.82 (observed)2    
18361515R.HQGVMVGMGQK.D1173.64 (observed)1    
18361515R.HQGVMVGMGQKDSYVGDEAQSK.R1175.13 (observed)2    
18361515R.KDLYANTVLSGGTTMYPGIADR.M1171.96 (observed)2    
18361515R.KDLYANTVLSGGTTMYPGIADR.M781.8 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGY.A1156.35 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGY.A1156.04 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1061.4 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1592.31 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L796.16 (observed)4    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1061.21 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L795.91 (observed)4    
18361515R.VAPEEHPVLLTEAPLNPK.A977.03 (observed)2    
18361515R.VAPEEHPVLLTEAPLNPK.A651.57 (observed)3    
18361515R.VAPEEHPVLLTEAPLNPK.A1956.07 (observed)1    
18361515R.VAPEEHPVLLTEAPLNPK.A977.03 (observed)2    
18361515R.VAPEEHPVLLTEAPLNPK.A1954.07 (observed)1    
18361515R.VAPEEHPVLLTEAPLNPK.A651.66 (observed)3    
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.87 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 42.51 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515S.GDGVTHTVPIYEGYALPHAILR.L793.41 (observed)3    
18361515S.KQEYDESGPSIVHR.K822.96 (observed)2    
18361515V.APEEHPVLLTEAPLNPK.A928.5 (observed)2    
18361515V.FPSIVGRPR.H514.67 (observed)2    
18361515K.AGFAGDDAPR.A488.73 (observed)2   peptide delta score: 35.05 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.05 (observed)2   peptide delta score: 121.2 
18361515K.DLYANTVLSGGTTMYPGIADR.M739.04 (observed)3   peptide delta score: 51.87 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.98 (observed)3   peptide delta score: 37.21 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.97 (observed)3   peptide delta score: 61.33 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.95 (observed)3   peptide delta score: 60.55 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.09 (observed)2   peptide delta score: 96.07 
18361515K.EITALAPSTMK.I581.33 (observed)2   peptide delta score: 44.22 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 31.72 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 51.49 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 49.91 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 53.92 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 52.58 
18361515K.IWHHTFYNELR.V505.87 (observed)3   peptide delta score: 39.28 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.78 (observed)3  NIPCAM (C)peptide delta score: 71.66 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.77 (observed)3  NIPCAM (C)peptide delta score: 101.7 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 57.99 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.67 (observed)3  NIPCAM (C)peptide delta score: 61.42 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 40.04 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.22 (observed)3   peptide delta score: 27.19 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 29.84 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 31.7 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 25.41 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 52.9 
18361515K.SYELPDGQVITIGNER.F895.85 (observed)2   peptide delta score: 37.53 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 70.44 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 59.06 
18361515K.SYELPDGQVITIGNER.F895.86 (observed)2   peptide delta score: 73.8 
18361515K.SYELPDGQVITIGNER.F597.6 (observed)3   peptide delta score: 64.7 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.82 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.95 
18361515K.SYELPDGQVITIGNER.F896 (observed)2   peptide delta score: 88.35 
18361515M.EEEIAALVIDNGSGMCK.A960.48 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 74.88 
18361515M.EEEIAALVIDNGSGMCK.A960.49 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 65.66 
18361515M.EEEIAALVIDNGSGMCK.A640.6 (observed)3   peptide delta score: 23.12 
18361515M.EEEIAALVIDNGSGMCK.A960.38 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 70.27 
18361515M.EEEIAALVIDNGSGMCK.A960.38 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 73.33 
18361515M.EEEIAALVIDNGSGMCK.A960.51 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 76.8 
18361515R.AVFPSIVGRPR.H400.25 (observed)3   peptide delta score: 39.2 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 26.95 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 40.67 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 24.32 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 30.31 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 26.78 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 32.1 
18361515R.AVFPSIVGRPR.H400.22 (observed)3   peptide delta score: 30.29 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 34.48 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.62 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 33.54 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 31.89 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 24.88 
18361515R.DLTDYLMK.I499.69 (observed)2   peptide delta score: 27.41 
18361515R.DLTDYLMK.I499.72 (observed)2   peptide delta score: 30.34 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 38.52 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 23.17 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 30.08 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 31.17 
18361515R.FRCPEALFQPSFLGMESCGIHETTFNSIMK.C905.47 (observed)4  2 NIPCAM (C)peptide delta score: 33.83 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 44.72 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 48.24 
18361515R.GYSFTTTAER.E566.75 (observed)2   peptide delta score: 40.87 
18361515R.GYSFTTTAER.E566.74 (observed)2   peptide delta score: 45.35 
18361515R.GYSFTTTAER.E566.73 (observed)2   peptide delta score: 40.93 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 36.67 
18361515R.HQGVMVGMGQK.D391.22 (observed)3   peptide delta score: 31.24 
18361515R.HQGVMVGMGQK.D391.25 (observed)3   peptide delta score: 35.6 
18361515R.HQGVMVGMGQK.D391.22 (observed)3   peptide delta score: 22.87 
18361515R.LDLAGRDLTDYLMK.I541.9 (observed)3   peptide delta score: 33.12 
18361515R.MQKEITALAPSTMK.I516.9 (observed)3   peptide delta score: 23.39 
18361515R.MQKEITALAPSTMK.I516.91 (observed)3   peptide delta score: 32.18 
18361515R.VAPEEHPVLLTEAPLNPK.A652.05 (observed)3   peptide delta score: 38.6 
18361515R.VAPEEHPVLLTEAPLNPK.A652.06 (observed)3   peptide delta score: 25.97 
18361515R.VAPEEHPVLLTEAPLNPK.A652.07 (observed)3   peptide delta score: 42.04 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 28.05 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 34.44 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 28.42 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 37.91 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 49.7 
18361515R.VAPEEHPVLLTEAPLNPK.A652.06 (observed)3   peptide delta score: 32.52 
18361515K.AGFAGDDAPR.A488.67 (observed)2   peptide delta score: 56.49 
18361515K.AGFAGDDAPR.A488.69 (observed)2   peptide delta score: 77.49 
18361515K.AGFAGDDAPR.A488.71 (observed)2   peptide delta score: 75.6 
18361515K.AGFAGDDAPR.A488.65 (observed)2   peptide delta score: 71.93 
18361515K.AGFAGDDAPR.A488.66 (observed)2   peptide delta score: 64.22 
18361515K.AGFAGDDAPR.A488.68 (observed)2   peptide delta score: 61.92 
18361515K.AGFAGDDAPR.A488.7 (observed)2   peptide delta score: 49.3 
18361515K.AGFAGDDAPR.A488.75 (observed)2   peptide delta score: 45.76 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 49.84 
18361515K.DSYVGDEAQSKR.G452.18 (observed)3   peptide delta score: 23.99 
18361515K.DSYVGDEAQSKR.G452.19 (observed)3   peptide delta score: 29.93 
18361515K.DSYVGDEAQSKR.G452.16 (observed)3   peptide delta score: 23.81 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 42.87 
18361515K.DSYVGDEAQSKR.G452.23 (observed)3   peptide delta score: 31.31 
18361515K.EITALAPSTMK.I589.25 (observed)2  Oxidation (M)peptide delta score: 33.09 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 45.38 
18361515K.EITALAPSTMK.I589.26 (observed)2  Oxidation (M)peptide delta score: 42.12 
18361515K.EITALAPSTMK.I581.34 (observed)2   peptide delta score: 47.98 
18361515K.EITALAPSTMK.I589.34 (observed)2  Oxidation (M)peptide delta score: 51.91 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 41.79 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 24.74 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 25.46 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 34.87 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 34.87 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 20.88 
18361515K.IIAPPER.K398.26 (observed)2   peptide delta score: 43.31 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.13 (observed)3   peptide delta score: 47.84 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 63.6 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 39.43 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 29.45 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 55.56 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 21.51 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 61.07 
18361515K.QEYDESGPSIVHR.K506.17 (observed)3   peptide delta score: 57.27 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.84 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.47 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 33.77 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 31.48 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 57.98 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 62.13 
18361515K.SYELPDGQVITIGNER.F895.91 (observed)2   peptide delta score: 55.38 
18361515K.SYELPDGQVITIGNER.F895.89 (observed)2   peptide delta score: 38.96 
18361515K.SYELPDGQVITIGNER.F895.85 (observed)2   peptide delta score: 58.19 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.84 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 46.97 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.33 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 23.06 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 38.12 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 39.28 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 31 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 28.87 
18361515R.AVFPSIVGRPR.H400.18 (observed)3   peptide delta score: 32.99 
18361515R.AVFPSIVGRPR.H400.19 (observed)3   peptide delta score: 29.98 
18361515R.DLTDYLMK.I507.69 (observed)2  Oxidation (M)peptide delta score: 32.07 
18361515R.DLTDYLMK.I499.77 (observed)2   peptide delta score: 37.77 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 50.35 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 24.52 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 24.52 
18361515R.GYSFTTTAER.E566.68 (observed)2   peptide delta score: 42.49 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 46.48 
18361515R.GYSFTTTAER.E566.79 (observed)2   peptide delta score: 45.57 
18361515R.HQGVMVGMGQK.D391.2 (observed)3   peptide delta score: 39.36 
18361515R.VAPEEHPVLLTEAPLNPK.A651.95 (observed)3   peptide delta score: 42.75 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 41.15 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 22.4 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 28.56 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 28.26 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 51.77 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 51.77 
18361515R.VAPEEHPVLLTEAPLNPK.A651.92 (observed)3   peptide delta score: 33.22 
18361515R.VAPEEHPVLLTEAPLNPK.A651.92 (observed)3   peptide delta score: 26.93 
18361515R.VAPEEHPVLLTEAPLNPK.A651.95 (observed)3   peptide delta score: 46.44 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 26.31 
18361515R.VAPEEHPVLLTEAPLNPK.A652.04 (observed)3   peptide delta score: 42.64 
18614015(K)AGFAGDDAPR(A)      peptide count: 85
18614015(K)CDVDIR(K)      peptide count: 5
18614015(K)CDVDIRK(D)      peptide count: 13
18614015(K)DLYANTVLSGGTTMYPGIADR(M)      peptide count: 9
18614015(K)DSYVGDEAQSK(R)      peptide count: 99
18614015(K)DSYVGDEAQSKR(G)      peptide count: 21
18614015(K)EITALAPSTMK(I)      peptide count: 82
18614015(K)IIAPPERK(Y)      peptide count: 50
18614015(K)IKIIAPPER(K)      peptide count: 2
18614015(K)IKIIAPPERK(Y)      peptide count: 1
18614015(K)IWHHTFYNELR(V)      peptide count: 34
18614015(K)LCYVALDFEQEMATAASSSSLEK(S)      peptide count: 6
18614015(K)MTQIMFETFNTPAMYVAIQAVLSLYASGR(T)      peptide count: 6
18614015(K)QEYDESGPSIVHR(K)      peptide count: 49
18614015(K)SYELPDGQVITIGNER(F)      peptide count: 51
18614015(R)AVFPSIVGRPR(H)      peptide count: 17
18614015(R)CPEALFQPSFLGMESCGIHETTFNSIMK(C)      peptide count: 1
18614015(R)DLTDYLMK(I)      peptide count: 65
18614015(R)EKMTQIMFETFNTPAMYVAIQAVLSLYASGR(T)      peptide count: 1
18614015(R)GILTLK(Y)      peptide count: 1
18614015(R)GYSFTTTAER(E)      peptide count: 47
18614015(R)HQGVMVGMGQK(D)      peptide count: 37
18614015(R)IIAPPER(D)      peptide count: 59
18614015(R)KDLYANTVLSGGTTMYPGIADR(M)      peptide count: 2
18614015(R)LDLAGR(D)      peptide count: 40
18614015(R)LDLAGRDLTDYLMK(I)      peptide count: 4
18614015(R)TTGIVMDSGDGVTHTVPIYEGYALPHAILR(L)      peptide count: 30
18614015(R)VAPEEHPVLLTEAPLNPK(A)      peptide count: 38
15253431IWHHTFYNKLR 2    
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 11   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 50   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 15   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 36   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 16   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 33   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 48   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 9   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 7   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 31   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 40   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 45   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 17   
UNPUBLISHED_1K.DLYANTVLSGGTTMYPGIADR.M    MS2 score: 31   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 12   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 34   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 9   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 8   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 20   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 7   
UNPUBLISHED_1K.DSYVGDEAQSKR.G    MS2 score: 30   
UNPUBLISHED_1K.DSYVGDEAQSKR.G    MS2 score: 20   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 15   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 10   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 24   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 24   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 19   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 1   
UNPUBLISHED_1K.IIAPPER.K    MS2 score: 0   
UNPUBLISHED_1K.IIAPPERK.Y    MS2 score: 2   
UNPUBLISHED_1K.IKIIAPPER.K    MS2 score: 14   
UNPUBLISHED_1K.IKIIAPPER.K    MS2 score: 9   
UNPUBLISHED_1K.IWHHTFYNELR.V    MS2 score: 9   
UNPUBLISHED_1K.IWHHTFYNELR.V    MS2 score: 12   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 2   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 1   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 9   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 14   
UNPUBLISHED_1K.QEYDESGPSIVHRK.C    MS2 score: 5   
UNPUBLISHED_1K.QEYDESGPSIVHRK.C    MS2 score: 1   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 5   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 7   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 9   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 11   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 19   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 24   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 15   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 41   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 48   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 18   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 29   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 29   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 20   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 21   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 48   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 45   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 40   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 32   
UNPUBLISHED_1K.SYELPDGQVITIGNERFR.C    MS2 score: 9   
UNPUBLISHED_1K.YPIEHGIVTNWDDMEK.I    MS2 score: 0   
UNPUBLISHED_1M.EEEIAALVIDNGSGMCKAGFAGDDAPR.A    MS2 score: 2   
21127740NLTDYLMK507.74 (observed)25.52E+0625.86 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 24.38
21127740NLTDYLMK499.75 (observed)21.76E+0630.23 (HPLC [min or %B])Deamidation (NQ)MS2 score: 31.08
21127740NLTDYLMK507.74 (observed)28.32E+0630.11 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 37.75
21127740NLTDYLMK499.75 (observed)26.89E+0630.47 (HPLC [min or %B])Deamidation (NQ)MS2 score: 35.14
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 22   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 16   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 32   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 28   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 27   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 11   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 24   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 3   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 6   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 33   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 23   
UNPUBLISHED_1R.DIKEK.L    MS2 score: 3   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 9   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 10   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 12   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 10   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 5   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 20   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 21   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 15   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 23   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 20   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 5   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 15   
UNPUBLISHED_1R.GYSFTTTAEREIVR.D    MS2 score: 15   
UNPUBLISHED_1R.GYSFTTTAEREIVR.D    MS2 score: 3   
UNPUBLISHED_1R.HQGVMVGMGQK.D    MS2 score: 3   
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 1   
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 10   
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 23   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 7   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 14   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 8   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 3   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 1   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 20   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 21   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 15   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 6   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 38   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 7   
23376485AGFAGDDAPR488.729 (observed)   :::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.28 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.28 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGR473.281 (observed)   ::::::::::
23376485AVFPSIVGRPR599.86 (observed)   ::::::::::::
23376485AVFPSIVGRPR599.858 (observed)   ::::::::::::
23376485CPEALFQPSFLGMESCGIHETTFNSIMK1088.494 (observed)   :Cys_CAM::::::::::::Oxidation_M:::Cys_CAM:::::::::::Oxidation_M::
23376485CPEALFQPSFLGMESCGIHETTFNSIMK1083.163 (observed)   :Cys_CAM::::::::::::Oxidation_M:::Cys_CAM:::::::::::::
23376485CPEALFQPSFLGMESCGIHETTFNSIMK1088.492 (observed)   :Cys_CAM::::::::::::Oxidation_M:::Cys_CAM:::::::::::Oxidation_M::
23376485DLTDYLMK499.748 (observed)   :::::::::
23376485DLTDYLMK507.746 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK499.75 (observed)   :::::::::
23376485DLTDYLMK507.749 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.747 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK499.748 (observed)   :::::::::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.745 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.746 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.746 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK507.746 (observed)   :::::::Oxidation_M::
23376485DLTDYLMK499.749 (observed)   :::::::::
23376485DLTDYLMK507.746 (observed)   :::::::Oxidation_M::
23376485DLYANTVLSGGTTMYPGIADR744.362 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1108.046 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.036 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.041 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.362 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR739.03 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.039 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.045 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.038 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.036 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.039 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.362 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.038 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.04 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.034 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.038 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.362 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1108.044 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR744.366 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.364 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.362 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR739.03 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR744.365 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.038 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.364 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.04 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1108.042 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR744.363 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.361 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.042 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1108.044 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR1108.046 (observed)   ::::::::::::::::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.04 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.364 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.363 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.041 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.039 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR744.364 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.04 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DLYANTVLSGGTTMYPGIADR1116.042 (observed)   ::::::::::::::Oxidation_M::::::::
23376485DSYVGDEAQSK599.767 (observed)   ::::::::::::
23376485DSYVGDEAQSK599.767 (observed)   ::::::::::::
23376485DSYVGDEAQSKR677.817 (observed)   :::::::::::::
23376485DSYVGDEAQSKR452.213 (observed)   :::::::::::::
23376485EEEIAALVIDNGSGMCK947.437 (observed)   :ACET_nterm::::::::::::::Oxidation_M:Cys_CAM::
23376485EEEIAALVIDNGSGMCK939.442 (observed)   :ACET_nterm:::::::::::::::Cys_CAM::
23376485EEEIAALVIDNGSGMCK947.438 (observed)   :ACET_nterm::::::::::::::Oxidation_M:Cys_CAM::
23376485EEEIAALVIDNGSGMCK939.435 (observed)   :ACET_nterm:::::::::::::::Cys_CAM::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK581.313 (observed)   ::::::::::::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.309 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.317 (observed)   ::::::::::::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK589.315 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.315 (observed)   ::::::::::::
23376485EITALAPSTMK589.316 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.316 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.313 (observed)   ::::::::::::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.312 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.315 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK589.315 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK581.314 (observed)   ::::::::::::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK589.311 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.316 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK589.314 (observed)   ::::::::::Oxidation_M::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK581.315 (observed)   ::::::::::::
23376485EITALAPSTMK581.316 (observed)   ::::::::::::
23376485EITALAPSTMK589.313 (observed)   ::::::::::Oxidation_M::
23376485EKLCYVALDFEQEMATAASSSSLEK936.447 (observed)   ::::Cys_CAM::::::::::::::::::::::
23376485EKLCYVALDFEQEMATAASSSSLEK941.778 (observed)   ::::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.771 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.765 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.772 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.765 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.766 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.767 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.768 (observed)   :::::::::::
23376485GYSFTTTAER566.769 (observed)   :::::::::::
23376485GYSFTTTAER566.77 (observed)   :::::::::::
23376485HQGVMVGMGQK401.859 (observed)   :::::Oxidation_M:::Oxidation_M::::
23376485HQGVMVGMGQK602.289 (observed)   :::::Oxidation_M:::Oxidation_M::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.921 (observed)   ::::::::::::
23376485IWHHTFYNELR505.921 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR505.921 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR505.921 (observed)   ::::::::::::
23376485IWHHTFYNELR758.383 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.924 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR758.381 (observed)   ::::::::::::
23376485IWHHTFYNELR758.38 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR758.381 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485IWHHTFYNELR505.924 (observed)   ::::::::::::
23376485IWHHTFYNELR505.924 (observed)   ::::::::::::
23376485IWHHTFYNELR505.922 (observed)   ::::::::::::
23376485IWHHTFYNELR505.923 (observed)   ::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.06 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR1180.091 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR781.727 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR781.728 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR1180.087 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.06 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.06 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.057 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.065 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR1180.085 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR1172.09 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR781.728 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.06 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR1180.089 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.059 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.059 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR1172.092 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.06 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR781.733 (observed)   :::::::::::::::::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.061 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.063 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.061 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.061 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.063 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.064 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.061 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.064 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.062 (observed)   :::::::::::::::Oxidation_M::::::::
23376485KDLYANTVLSGGTTMYPGIADR787.064 (observed)   :::::::::::::::Oxidation_M::::::::
23376485LCYVALDFEQEMATAASSSSLEK1283.597 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1275.601 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1275.595 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1275.596 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.736 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.734 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1283.595 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.064 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.064 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.733 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1283.593 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.065 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.064 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.068 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.732 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1283.594 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1275.594 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK1283.588 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.062 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.062 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.733 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.066 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.062 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK856.063 (observed)   ::Cys_CAM::::::::::Oxidation_M::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.733 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.733 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485LCYVALDFEQEMATAASSSSLEK850.736 (observed)   ::Cys_CAM::::::::::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.86 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.243 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.861 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.865 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.86 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.856 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.858 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.858 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.239 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.856 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.239 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.861 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.244 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.858 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.243 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.869 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.856 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.858 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.86 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.86 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.241 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.857 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.856 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.859 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.24 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR506.242 (observed)   ::::::::::::::
23376485QEYDESGPSIVHR758.86 (observed)   ::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.636 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.638 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.958 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.949 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.949 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.956 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.948 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.949 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.637 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.638 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.959 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.638 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.639 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.951 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER597.64 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.95 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.955 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.954 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.952 (observed)   :::::::::::::::::
23376485SYELPDGQVITIGNER895.953 (observed)   :::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1061.879 (observed)   :::::::::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.21 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR796.663 (observed)   :::::::::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR796.663 (observed)   :::::::::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.207 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR800.662 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR796.665 (observed)   :::::::::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1061.877 (observed)   :::::::::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.214 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1600.323 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.215 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR800.66 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.215 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR800.66 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR800.66 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR1067.21 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485TTGIVMDSGDGVTHTVPIYEGYALPHAILR800.659 (observed)   ::::::Oxidation_M:::::::::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.537 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.536 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.536 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.537 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.536 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.542 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.542 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.544 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.546 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.539 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.543 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.536 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.537 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.539 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.027 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.539 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.028 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.027 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.544 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.539 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.539 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.546 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.027 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.54 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.541 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.029 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK652.03 (observed)   :::::::::::::::::::
23376485VAPEEHPVLLTEAPLNPK977.538 (observed)   :::::::::::::::::::
23376485YPIEHGIVTNWDDMEK980.957 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK988.959 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK980.961 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK654.31 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK654.31 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK654.307 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK988.958 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK980.963 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK654.311 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK654.31 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK654.311 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK988.956 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK980.963 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.643 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK654.312 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK659.643 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK654.306 (observed)   :::::METH_core::::::::::::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK659.642 (observed)   :::::METH_core:::::::::Oxidation_M:::
23376485YPIEHGIVTNWDDMEK654.312 (observed)   :::::METH_core::::::::::::

Compile date 12-23-2014© PADB initiative