PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A4548ACTB, PS1TP5BP1Actin, cytoplasmic 1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
15020595A.PEEHPVLLTEAPLNPK.A       
16709260AGFAGDDAPR-0.575432066 (delta mass [ppm])2   MS2 score: 55 
16948836AGFAGDDAPR0.8 (delta mass [ppm])2    
16948836AGFAGDDAPR0.4 (delta mass [ppm])2    
16948836AGFAGDDAPR0.3 (delta mass [ppm])2    
16948836AGFAGDDAPR0.7 (delta mass [ppm])2    
16948836AGFAGDDAPR2.2 (delta mass [ppm])2    
16948836AGFAGDDAPR2.3 (delta mass [ppm])2    
16446289APEEHPVLLTEAPLNPKA 2   peptide count: 9
16948836AVFPSIVGR0.6 (delta mass [ppm])2    
16948836AVFPSIVGR1.3 (delta mass [ppm])2    
16948836AVFPSIVGR0.5 (delta mass [ppm])2    
16948836AVFPSIVGR0.5 (delta mass [ppm])2    
16948836AVFPSIVGR2 (delta mass [ppm])2    
16948836AVFPSIVGR0.1 (delta mass [ppm])2    
16948836AVFPSIVGRPR1.6 (delta mass [ppm])2    
16948836CPEALFQPSFLGMESCGIHETTFNSIMK3.7 (delta mass [ppm])3    
16709260DDDIAALVVDNGSGMCK0.303713984 (delta mass [ppm])2   MS2 score: 88 
16948836DDDIAALVVDNGSGMCK0.2 (delta mass [ppm])2    
16948836DDDIAALVVDNGSGMCK1.9 (delta mass [ppm])2    
16948836DDDIAALVVDNGSGMCK1.4 (delta mass [ppm])2    
16948836DDDIAALVVDNGSGMCK0.6 (delta mass [ppm])2    
16709260DLTDYLMK0.768737974 (delta mass [ppm])1   MS2 score: 38 
16948836DLTDYLMK1.1 (delta mass [ppm])2    
16948836DLTDYLMK0.8 (delta mass [ppm])2    
16948836DLTDYLMK1.5 (delta mass [ppm])2    
16948836DLTDYLMK0.3 (delta mass [ppm])2    
16709260DLYANTVLSGGTTMYPGIADR-2.452956816 (delta mass [ppm])2   MS2 score: 75 
16948836DLYANTVLSGGTTMYPGIADR0.7 (delta mass [ppm])2    
16948836DLYANTVLSGGTTMYPGIADR1.3 (delta mass [ppm])2    
16948836DLYANTVLSGGTTMYPGIADR1.7 (delta mass [ppm])2    
16948836DLYANTVLSGGTTMYPGIADR0.6 (delta mass [ppm])2    
16948836DSYVGDEAQSK0.1 (delta mass [ppm])2    
16948836DSYVGDEAQSK0.1 (delta mass [ppm])2    
16709260DSYVGDEAQSKR1.43098189 (delta mass [ppm])2   MS2 score: 47 
16709260EITALAPSTMK-2.033411564 (delta mass [ppm])1   MS2 score: 45 
16948836EITALAPSTMK2.5 (delta mass [ppm])2    
16948836EITALAPSTMK0.2 (delta mass [ppm])2    
16948836EITALAPSTMK1.5 (delta mass [ppm])2    
16948836EITALAPSTMK1 (delta mass [ppm])2    
16948836EITALAPSTMK0.3 (delta mass [ppm])2    
16948836EITALAPSTMK0.5 (delta mass [ppm])2    
16709260GYSFTTTAER0.564727288 (delta mass [ppm])2   MS2 score: 62 
16948836GYSFTTTAER1.3 (delta mass [ppm])2    
16948836GYSFTTTAER0.3 (delta mass [ppm])2    
16948836GYSFTTTAER1.4 (delta mass [ppm])2    
16948836GYSFTTTAER0.6 (delta mass [ppm])2    
16948836GYSFTTTAER2.5 (delta mass [ppm])2    
16948836GYSFTTTAER1.4 (delta mass [ppm])2    
16948836GYSFTTTAER0.1 (delta mass [ppm])2    
16948836GYSFTTTAER2.4 (delta mass [ppm])2    
16709260HQGVMVGMGQK1.055901496 (delta mass [ppm])2   MS2 score: 55 
16948836HQGVMVGMGQK0.7 (delta mass [ppm])2    
16948836HQGVMVGMGQK2.2 (delta mass [ppm])3    
16948836HQGVMVGMGQK1.3 (delta mass [ppm])3    
16948836HQGVMVGMGQK2.1 (delta mass [ppm])2    
16948836IIAPPER0.9 (delta mass [ppm])2    
16948836IIAPPER1.3 (delta mass [ppm])2    
16709260IIAPPERK1.153312582 (delta mass [ppm])2   MS2 score: 31 
16709260IWHHTFYNELR-0.684605109 (delta mass [ppm])2   MS2 score: 43 
16948836IWHHTFYNELR1.3 (delta mass [ppm])3    
16948836IWHHTFYNELR1.2 (delta mass [ppm])3    
16948836IWHHTFYNELR0.9 (delta mass [ppm])3    
16948836IWHHTFYNELR2.2 (delta mass [ppm])3    
15020595K.AGFAGDDAPR.A       
15020595K.DLYANTVLSGGTTM#YPGIADR.M       
16507876K.DLYANTVLSGGTTMYPGIADR.M2231.1 (expected)2    
15020595K.EITALAPSTMK.I       
15020595K.IWHHTFYNELR.V       
16507876K.LCYVALDFEQEMATAASSSSLEK.S2745.2 (expected)2    
15020595K.QEYDESGPSIVHR.K       
15020595K.SYELPDGQVITIGNER.F       
17381150KAGFAGDDAPRA      
17381150KCDVDIRK      
16446289KDLYANTVLSGGTTM*YPGIADRM 2   peptide count: 4
18501002KDLYANTVLSGGTTM*YPGIADRM 2    
18501002KDLYANTVLSGGTTM*YPGIADRM 3    
16948836KDLYANTVLSGGTTMYPGIADR3.6 (delta mass [ppm])3    
16446289KDLYANTVLSGGTTMYPGIADRM 2   peptide count: 2
18501002KDLYANTVLSGGTTMYPGIADRM 2    
17381150KDLYANTVLSGGTTMYPGIADRM   1Met-ox  
16446289KEITALAPSTM*KI 2   peptide count: 3
16446289KEITALAPSTMKI 2   peptide count: 2
17381150KIIAPPERK      
16446289KILTERGYSFTTTAERE 2   peptide count: 2
16446289KIWHHTFYNELRV 2   peptide count: 4
18501002KIWHHTFYNELRV 2    
18501002KIWHHTFYNELRV 3    
17381150KLCYVALDFEQEMATAASSSSLEKS   1Met-ox  
18501002KQEYDESGPSIVHRK 3    
17381150KQEYDESGPSIVHRK   pyroGlu  
17381150KQEYDESGPSIVHRK      
18501002KRGILTLKYPIEHGIVTNWDDM*EKI 3    
16446289KSYELPDGQVITIGNERF 2   peptide count: 18
17381150KSYELPDGQVITIGNERF      
16446289KYPIEHGIVTNWDDM*EKI 2   peptide count: 1
16446289KYPIEHGIVTNWDDMEKI 2   peptide count: 3
16948836KYSVWIGGSILASLSTFQQMWISK0.5 (delta mass [ppm])3    
16948836LCYVALDFEQEMATAASSSSLEK1.3 (delta mass [ppm])2    
16948836LCYVALDFEQEMATAASSSSLEK1.4 (delta mass [ppm])2    
16446289LRVAPEEHPVLLTEAPLNPKA 3   peptide count: 1
16948836MTQIMFETFNTPAMYVAIQAVLSLYASGR4.7 (delta mass [ppm])3    
16948836MTQIMFETFNTPAMYVAIQAVLSLYASGR4.3 (delta mass [ppm])3    
16446289NTVLSGGTTM*YPGIADRM 2   peptide count: 1
16446289NTVLSGGTTMYPGIADRM 2   peptide count: 2
16709260QEYDESGPSIVHR1.592008602 (delta mass [ppm])2   MS2 score: 49 
16948836QEYDESGPSIVHR1.2 (delta mass [ppm])2    
16948836QEYDESGPSIVHR4.2 (delta mass [ppm])3    
16948836QEYDESGPSIVHR1.6 (delta mass [ppm])3    
16948836QEYDESGPSIVHR0.2 (delta mass [ppm])2    
16507876R.CPEALFQPSFLGMESCGIHETTFNSIMK.C3603.4 (expected)3    
15020595R.GYSFTTTAER.E       
15020595R.KDLYANTVLSGGTTM#YPGIADR.M       
16507876R.KDLYANTVLSGGTTMYPGIADR.M2359.2 (expected)2    
15020595R.TTGIVM#DSGDGVTHTVPIYEGYALPH.A       
16507876R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L3199.6 (expected)3    
16507876R.VAPEEHPVLLTEAPLNPK.A1954.1 (expected)2    
15020595R.VAPEEHPVLLTEAPLNPK.A       
16446289RAVFPSIVGRPRH 2   peptide count: 6
17381150RAVFPSIVGRPRH      
16446289RCPEALFQPSFLGMESCGIHETTFNSIMKC 3   peptide count: 1
16446289RDLTDYLM*KI 1   peptide count: 1
16446289RDLTDYLM*KI 2   peptide count: 2
16446289RDLTDYLMKI 1   peptide count: 2
16446289RDLTDYLMKI 2   peptide count: 2
17381150RDLTDYLMKI   1Met-ox  
16446289RFRCPEALFQPSFLGM*ESC 2   peptide count: 1
16446289RFRCPEALFQPSFLGMESC 2   peptide count: 3
16948836RGILTLK0.3 (delta mass [ppm])2    
16446289RGYSFTTTAERE 2   peptide count: 11
18501002RGYSFTTTAERE 2    
17381150RGYSFTTTAERE      
17381150RHQGVMVGMGQKD   2Met-ox  
16446289RKDLYANTVLSGGTTM*YPGIADRM 2   peptide count: 3
16446289RKDLYANTVLSGGTTM*YPGIADRM 3   peptide count: 2
18501002RKDLYANTVLSGGTTM*YPGIADRM 2    
18501002RKDLYANTVLSGGTTM*YPGIADRM 3    
16446289RKDLYANTVLSGGTTMYPGIADRM 2   peptide count: 2
16446289RKDLYANTVLSGGTTMYPGIADRM 3   peptide count: 1
18501002RKDLYANTVLSGGTTMYPGIADRM 2    
18501002RKDLYANTVLSGGTTMYPGIADRM 3    
17381150RKDLYANTVLSGGTTMYPGIADRM   1Met-ox  
17381150RLDLAGRD      
16446289RTTGIVM*DSGDGVTHTVPIYEGYA 2   peptide count: 7
16446289RTTGIVM*DSGDGVTHTVPIYEGYALPHA 3   peptide count: 3
16446289RTTGIVM*DSGDGVTHTVPIYEGYALPHAILRL 3   peptide count: 12
18501002RTTGIVM*DSGDGVTHTVPIYEGYALPHAILRL 3    
16446289RTTGIVMDSGDGVTHTVPIYEGYA 2   peptide count: 10
16446289RTTGIVMDSGDGVTHTVPIYEGYALPHA 3   peptide count: 1
16446289RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL 3   peptide count: 25
18501002RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL 3    
17381150RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL   1Met-ox  
16446289RVAPEEHPVLLTEAPLNP 2   peptide count: 2
16446289RVAPEEHPVLLTEAPLNPKA 2   peptide count: 12
16446289RVAPEEHPVLLTEAPLNPKA 3   peptide count: 3
18501002RVAPEEHPVLLTEAPLNPKA 2    
18501002RVAPEEHPVLLTEAPLNPKA 3    
17381150RVAPEEHPVLLTEAPLNPKA      
17723740RVAPEEHPVLLTEAPLNPKA     deltaCN (delta correlation): 17723740 
16709260SYELPDGQVITIGNER1.478307623 (delta mass [ppm])2   MS2 score: 73 
16948836SYELPDGQVITIGNER1.4 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER1.1 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER0.9 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER2.4 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER1.3 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER0.7 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER3.3 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER3.5 (delta mass [ppm])2    
16948836SYELPDGQVITIGNER3.1 (delta mass [ppm])2    
16709260TTGIVMDSGDGVTHTVPIYEGYALPHAILR-3.314264114 (delta mass [ppm])3   MS2 score: 38 
16948836TTGIVMDSGDGVTHTVPIYEGYALPHAILR0.3 (delta mass [ppm])3    
16948836TTGIVMDSGDGVTHTVPIYEGYALPHAILR4.6 (delta mass [ppm])3    
16709260VAPEEHPVLLTEAPLNPK-1.440818124 (delta mass [ppm])2   MS2 score: 48 
16948836VAPEEHPVLLTEAPLNPK2.7 (delta mass [ppm])2    
16948836VAPEEHPVLLTEAPLNPK3.5 (delta mass [ppm])2    
16948836VAPEEHPVLLTEAPLNPK1.2 (delta mass [ppm])3    
16316981VAPEEHPVLLTEAPLNPK      peptide count: 4
16948836YSVWIGGSILASLSTFQQMWISK3.8 (delta mass [ppm])3    
16684767APEEHPVLLTEAPLNPKA 2    
16684767DDIAALVVDNGSGMCKA 2    
16684767KAGFAGDDAPRA 1    
16684767KCDVDIRK 1    
16684767KCDVDIRKD 2    
16684767KCDVDIRKDLYANTVLSGGTTM*YPGIADRM 3    
16684767KCDVDIRKDLYANTVLSGGTTMYPGIADRM 3    
16684767KDLYANTVLSGGTTM*YPGIADRM 2    
16684767KDLYANTVLSGGTTMYPGIADRM 2    
16684767KDSYVGDEAQSKR 1    
16684767KDSYVGDEAQSKRG 2    
16684767KEITALAPSTM*KI 1    
16684767KEITALAPSTMKI 1    
16684767KEKLCYVALDFEQEM*ATAASSSSLEKS 3    
16684767KEKLCYVALDFEQEMATAASSSSLEKS 2    
16684767KIIAPPERKY 2    
16684767KIKIIAPPERK 1    
16684767KIKIIAPPERKY 2    
16684767KIWHHTFYNELRV 1    
16684767KLCYVALDFEQEM*ATAASSSSLEKS 2    
16684767KLCYVALDFEQEMATAASSSSLEKS 2    
16684767KMTQIMFETFNTPAMYVAIQAVLSLYASGRT 3    
16684767KQEYDESGPSIVHRK 2    
16684767KQEYDESGPSIVHRKC 2    
16684767LRVAPEEHPVLLTEAPLNPKA 2    
16684767NSIM*KCDVDIRKDLYANTVLSGGTTMYPGIADRM 3    
16684767RAVFPSIVGRPRH 2    
16684767RCPEALFQPSFLGM*ESCGIHETTFNSIM*KC 3    
16684767RCPEALFQPSFLGM*ESCGIHETTFNSIMKC 2    
16684767RCPEALFQPSFLGMESCGIHETTFNSIM*KC 3    
16684767RCPEALFQPSFLGMESCGIHETTFNSIMKC 2    
16684767RDLTDYLM*KI 1    
16684767RDLTDYLMKI 1    
16684767RFRCPEALFQPSFLGM*ESCGIHETTFNSIM*KC 3    
16684767RFRCPEALFQPSFLGM*ESCGIHETTFNSIMKC 3    
16684767RFRCPEALFQPSFLGMESCGIHETTFNSIM*KC 3    
16684767RFRCPEALFQPSFLGMESCGIHETTFNSIMKC 3    
16684767RGYSFTTTAERE 1    
16684767RGYSFTTTAEREIVRD 2    
16684767RHQGVM*VGM*GQKDSYVGDEAQSKR 3    
16684767RHQGVM*VGMGQKD 1    
16684767RHQGVMVGM*GQKD 1    
16684767RHQGVMVGM*GQKDSYVGDEAQSKR 3    
16684767RHQGVMVGMGQKD 1    
16684767RHQGVMVGMGQKDSYVGDEAQSKR 2    
16684767RHQGVMVGMGQKDSYVGDEAQSKRG 3    
16684767RKDLYANTVLSGGTTM*YPGIADRM 2    
16684767RKDLYANTVLSGGTTMYPGIADRM 2    
16684767RLDLAGRDLTDYLM*KI 3    
16684767RLDLAGRDLTDYLMKI 2    
16684767RM*QKEITALAPSTM*KI 2    
16684767RMQKEITALAPSTM*KI 2    
16684767RMQKEITALAPSTMKI 2    
16684767RTTGIVM*DSGDGVTHTVPIYEGYALPHAILRL 3    
16684767RTTGIVMDSGDGVTHTVPIYEGYALPHA 3    
16684767RTTGIVMDSGDGVTHTVPIYEGYALPHAILRL 2    
16684767RVAPEEHPVLLTEAPLNPKA 1    
18361515A.LVVDNGSGMCK.A1179.55 (observed)1    
18361515A.PEEHPVLLTEAPLNPK.A892.46 (observed)2    
18361515D.GQVITIGNER.F543.3 (observed)2    
18361515D.GVTHTVPIYEGYALPHAILR.L735.88 (observed)3    
18361515D.GVTHTVPIYEGYALPHAILR.L1104.03 (observed)2    
18361515D.GVTHTVPIYEGYALPHAILR.L736.28 (observed)3    
18361515D.LYANTVLSGGTTMYPGIADR.M1049.95 (observed)2    
18361515E.GYALPHAILR.L555.19 (observed)2    
18361515E.HPVLLTEAPLNPK.A714.47 (observed)2    
18361515E.HPVLLTEAPLNPK.A714.78 (observed)2    
18361515E.LPDGQVITIGNER.F1411.75 (observed)1    
18361515G.YALPHAILR.L526.79 (observed)2    
18361515K.AGFAGDDAPR.A976.45 (observed)1    
18361515K.AGFAGDDAPR.A488.73 (observed)2    
18361515K.AGFAGDDAPR.A488.54 (observed)2    
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 61.51 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPR.A2   peptide delta score: 57.62 
18361515K.AGFAGDDAPRAVFPSIVGRPR.H719.64 (observed)3    
18361515K.DLYANTVLSGGTTMYPGIADR.M1107.73 (observed)2    
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.04 (observed)2    
18361515K.DSYVGDEAQSK.R599.8 (observed)2    
18361515K.DSYVGDEAQSK.R1200.53 (observed)1    
18361515K.DSYVGDEAQSK.R1198.38 (observed)1    
18361515K.DSYVGDEAQSK.R600.21 (observed)2    
18361515K.EITALAPSTMK.I1162.54 (observed)1    
18361515K.EITALAPSTMK.I581.31 (observed)2    
18361515K.EITALAPSTMK.I581.01 (observed)2    
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EITALAPSTMK.I2   peptide delta score: 52.62 
18361515K.EKLCYVALDFEQEMATAASSSSLEK.S937.08 (observed)3    
18361515K.IWHHTFYN.E1117.17 (observed)1    
18361515K.IWHHTFYNELR.V758.15 (observed)2    
18361515K.IWHHTFYNELR.V505.77 (observed)3    
18361515K.IWHHTFYNELR.V505.25 (observed)3    
18361515K.IWHHTFYNELR.V758.21 (observed)2    
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELR.V3   peptide delta score: 64.82 
18361515K.IWHHTFYNELR.V3  Deamidation (NQ)peptide delta score: 42.26 
18361515K.IWHHTFYNELRVAPEEHPVLLTEAPLNPK.A1151.34 (observed)3    
18361515K.LCYVALDFEQEMATAASSSSLEK.S1275.84 (observed)2    
18361515K.LCYVALDFEQEMATAASSSSLEK.S1275.09 (observed)2    
18361515K.LCYVALDFEQEMATAASSSSLEK.S850.39 (observed)3    
18361515K.QEYDESGPSIVHR.K759.14 (observed)2    
18361515K.QEYDESGPSIVHR.K759.24 (observed)2    
18361515K.QEYDESGPSIVHR.K506.18 (observed)3    
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.QEYDESGPSIVHR.K3  Deamidation (NQ)peptide delta score: 64.41 
18361515K.QEYDESGPSIVHR.K3  Pyro-glu (N-term Q)peptide delta score: 66.29 
18361515K.SYELPDGQVITIGNER.F896.95 (observed)2    
18361515K.SYELPDGQVITIGNER.F895.45 (observed)2    
18361515K.SYELPDGQVITIGNER.F1790.89 (observed)1    
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.SYELPDGQVITIGNER.F2   peptide delta score: 42.24 
18361515K.YSVWIGGSILASLSTFQQMWISK.Q1301.67 (observed)2    
18361515L.PDGQVITIGNER.F649.34 (observed)2    
18361515L.PDGQVITIGNER.F1298.67 (observed)1    
18361515L.RVAPEEHPVLLTEAPLNPK.A703.72 (observed)3    
18361515L.RVAPEEHPVLLTEAPLNPK.A1055.59 (observed)2    
18361515L.VVDNGSGMCK.A1067.47 (observed)1    
18361515M.DSGDGVTHTVPIYEGYALPHAILR.L861.94 (observed)3    
18361515N.TVLSGGTTMYPGIADR.M819.8 (observed)2    
18361515N.TVLSGGTTMYPGIADR.M820.15 (observed)2    
18361515N.VLSGGTTMYPGIADR.M769.53 (observed)2    
18361515N.VLSGGTTMYPGIADR.M768.65 (observed)2    
18361515P.PEEHPVLLTEAPLNPK.A891.98 (observed)2    
18361515Q.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGR.P472.78 (observed)2    
18361515R.AVFPSIVGR.P945.55 (observed)1    
18361515R.AVFPSIVGR.P473.36 (observed)2    
18361515R.AVFPSIVGRPR.H599.65 (observed)2    
18361515R.AVFPSIVGRPR.H599.78 (observed)2    
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.AVFPSIVGRPR.H1   peptide delta score: 45.93 
18361515R.CPEALFQPSFLGMESCGIHETTFNSIMK.C1078.09 (observed)3    
18361515R.CPEALFQPSFLGMESCGIHETTFNSIMK.C1078.28 (observed)3    
18361515R.DLTDYLMK.I999.49 (observed)1    
18361515R.DLTDYLMK.I499.85 (observed)2    
18361515R.DLTDYLMK.I498.82 (observed)2    
18361515R.DLTDYLMK.I998.49 (observed)1    
18361515R.GYSFTTTAER.E566.36 (observed)2    
18361515R.GYSFTTTAER.E566.92 (observed)2    
18361515R.GYSFTTTAER.E2   peptide delta score: 48.5 
18361515R.GYSFTTTAER.E2   peptide delta score: 48.5 
18361515R.GYSFTTTAER.E2   peptide delta score: 48.5 
18361515R.GYSFTTTAER.E2   peptide delta score: 45.55 
18361515R.GYSFTTTAER.E2   peptide delta score: 45.55 
18361515R.GYSFTTTAER.E2   peptide delta score: 45.55 
18361515R.HQGVMVGMGQK.D586 (observed)2    
18361515R.HQGVMVGMGQK.D1173.56 (observed)1    
18361515R.HQGVMVGMGQK.D585.82 (observed)2    
18361515R.HQGVMVGMGQK.D1173.64 (observed)1    
18361515R.HQGVMVGMGQKDSYVGDEAQSK.R1175.13 (observed)2    
18361515R.KDLYANTVLSGGTTMYPGIADR.M1171.96 (observed)2    
18361515R.KDLYANTVLSGGTTMYPGIADR.M781.8 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGY.A1156.35 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGY.A1156.04 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1061.4 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1592.31 (observed)2    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L796.16 (observed)4    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L1061.21 (observed)3    
18361515R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L795.91 (observed)4    
18361515R.VAPEEHPVLLTEAPLNPK.A977.03 (observed)2    
18361515R.VAPEEHPVLLTEAPLNPK.A651.57 (observed)3    
18361515R.VAPEEHPVLLTEAPLNPK.A1956.07 (observed)1    
18361515R.VAPEEHPVLLTEAPLNPK.A977.03 (observed)2    
18361515R.VAPEEHPVLLTEAPLNPK.A1954.07 (observed)1    
18361515R.VAPEEHPVLLTEAPLNPK.A651.66 (observed)3    
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.87 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.87 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.87 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 42.51 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 42.51 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 42.51 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515R.VAPEEHPVLLTEAPLNPK.A3   peptide delta score: 43.08 
18361515S.GDGVTHTVPIYEGYALPHAILR.L793.41 (observed)3    
18361515S.KQEYDESGPSIVHR.K822.96 (observed)2    
18361515V.APEEHPVLLTEAPLNPK.A928.5 (observed)2    
18361515V.FPSIVGRPR.H514.67 (observed)2    
18361515V.VDNGSGMCK.A967.4 (observed)1    
18361515K.AGFAGDDAPR.A488.73 (observed)2   peptide delta score: 35.05 
18361515K.AGFAGDDAPR.A488.73 (observed)2   peptide delta score: 35.05 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.05 (observed)2   peptide delta score: 121.2 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.05 (observed)2   peptide delta score: 121.2 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.05 (observed)2   peptide delta score: 121.2 
18361515K.DLYANTVLSGGTTMYPGIADR.M739.04 (observed)3   peptide delta score: 51.87 
18361515K.DLYANTVLSGGTTMYPGIADR.M739.04 (observed)3   peptide delta score: 51.87 
18361515K.DLYANTVLSGGTTMYPGIADR.M739.04 (observed)3   peptide delta score: 51.87 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.98 (observed)3   peptide delta score: 37.21 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.98 (observed)3   peptide delta score: 37.21 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.98 (observed)3   peptide delta score: 37.21 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.97 (observed)3   peptide delta score: 61.33 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.97 (observed)3   peptide delta score: 61.33 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.97 (observed)3   peptide delta score: 61.33 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.95 (observed)3   peptide delta score: 60.55 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.95 (observed)3   peptide delta score: 60.55 
18361515K.DLYANTVLSGGTTMYPGIADR.M738.95 (observed)3   peptide delta score: 60.55 
18361515K.DLYANTVLSGGTTMYPGIADR.M1108.09 (observed)2   peptide delta score: 96.07 
18361515K.EITALAPSTMK.I581.33 (observed)2   peptide delta score: 44.22 
18361515K.EITALAPSTMK.I581.33 (observed)2   peptide delta score: 44.22 
18361515K.EITALAPSTMK.I581.33 (observed)2   peptide delta score: 44.22 
18361515K.EITALAPSTMK.I581.33 (observed)2   peptide delta score: 44.22 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 31.72 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 31.72 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 31.72 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 31.72 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 51.49 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 51.49 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 51.49 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 51.49 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 49.91 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 49.91 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 49.91 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 49.91 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 53.92 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 53.92 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 53.92 
18361515K.EITALAPSTMK.I581.27 (observed)2   peptide delta score: 53.92 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 52.58 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 52.58 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 52.58 
18361515K.EITALAPSTMK.I581.26 (observed)2   peptide delta score: 52.58 
18361515K.IWHHTFYNELR.V505.87 (observed)3   peptide delta score: 39.28 
18361515K.IWHHTFYNELR.V505.87 (observed)3   peptide delta score: 39.28 
18361515K.IWHHTFYNELR.V505.87 (observed)3   peptide delta score: 39.28 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.78 (observed)3  NIPCAM (C)peptide delta score: 71.66 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.78 (observed)3  NIPCAM (C)peptide delta score: 71.66 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.78 (observed)3  NIPCAM (C)peptide delta score: 71.66 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.77 (observed)3  NIPCAM (C)peptide delta score: 101.7 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.77 (observed)3  NIPCAM (C)peptide delta score: 101.7 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.77 (observed)3  NIPCAM (C)peptide delta score: 101.7 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 57.99 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 57.99 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 57.99 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.67 (observed)3  NIPCAM (C)peptide delta score: 61.42 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.67 (observed)3  NIPCAM (C)peptide delta score: 61.42 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.67 (observed)3  NIPCAM (C)peptide delta score: 61.42 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 40.04 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 40.04 
18361515K.LCYVALDFEQEMATAASSSSLEK.S864.68 (observed)3  NIPCAM (C)peptide delta score: 40.04 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.22 (observed)3   peptide delta score: 27.19 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.22 (observed)3   peptide delta score: 27.19 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 29.84 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 29.84 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 29.84 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 31.7 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 31.7 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 31.7 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 31.7 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 25.41 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 25.41 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 25.41 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 25.41 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 52.9 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 52.9 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 52.9 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 52.9 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 70.44 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 59.06 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 70.44 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 59.06 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 70.44 
18361515K.SYELPDGQVITIGNER.F895.97 (observed)2   peptide delta score: 59.06 
18361515K.SYELPDGQVITIGNER.F895.86 (observed)2   peptide delta score: 73.8 
18361515K.SYELPDGQVITIGNER.F895.86 (observed)2   peptide delta score: 73.8 
18361515K.SYELPDGQVITIGNER.F895.86 (observed)2   peptide delta score: 73.8 
18361515K.SYELPDGQVITIGNER.F597.6 (observed)3   peptide delta score: 64.7 
18361515K.SYELPDGQVITIGNER.F597.6 (observed)3   peptide delta score: 64.7 
18361515K.SYELPDGQVITIGNER.F597.6 (observed)3   peptide delta score: 64.7 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.82 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.82 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.82 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.95 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.95 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.95 
18361515K.SYELPDGQVITIGNER.F896 (observed)2   peptide delta score: 88.35 
18361515M.DDDIAALVVDNGSGMCK.A932.44 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 81.01 
18361515M.DDDIAALVVDNGSGMCK.A932.48 (observed)2  N-Acetyl (Protein); NIPCAM (C)peptide delta score: 61.35 
18361515R.AVFPSIVGRPR.H400.25 (observed)3   peptide delta score: 39.2 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 26.95 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 40.67 
18361515R.AVFPSIVGRPR.H400.25 (observed)3   peptide delta score: 39.2 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 26.95 
18361515R.AVFPSIVGRPR.H400.26 (observed)3   peptide delta score: 40.67 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 24.32 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 30.31 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 24.32 
18361515R.AVFPSIVGRPR.H400.24 (observed)3   peptide delta score: 30.31 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 26.78 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 26.78 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 32.1 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 32.1 
18361515R.AVFPSIVGRPR.H400.22 (observed)3   peptide delta score: 30.29 
18361515R.AVFPSIVGRPR.H400.22 (observed)3   peptide delta score: 30.29 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 34.48 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 34.48 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.62 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.62 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 33.54 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 33.54 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 31.89 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 31.89 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 31.89 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 24.88 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 24.88 
18361515R.DLTDYLMK.I499.75 (observed)2   peptide delta score: 24.88 
18361515R.DLTDYLMK.I499.69 (observed)2   peptide delta score: 27.41 
18361515R.DLTDYLMK.I499.69 (observed)2   peptide delta score: 27.41 
18361515R.DLTDYLMK.I499.69 (observed)2   peptide delta score: 27.41 
18361515R.DLTDYLMK.I499.72 (observed)2   peptide delta score: 30.34 
18361515R.DLTDYLMK.I499.72 (observed)2   peptide delta score: 30.34 
18361515R.DLTDYLMK.I499.72 (observed)2   peptide delta score: 30.34 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 38.52 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 38.52 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 38.52 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 23.17 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 23.17 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 30.08 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 30.08 
18361515R.DLTDYLMK.I499.71 (observed)2   peptide delta score: 30.08 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 43.54 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 31.17 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 31.17 
18361515R.DLTDYLMK.I499.7 (observed)2   peptide delta score: 31.17 
18361515R.FRCPEALFQPSFLGMESCGIHETTFNSIMK.C905.47 (observed)4  2 NIPCAM (C)peptide delta score: 33.83 
18361515R.FRCPEALFQPSFLGMESCGIHETTFNSIMK.C905.47 (observed)4  2 NIPCAM (C)peptide delta score: 33.83 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 44.72 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 44.72 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 44.72 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 48.24 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 48.24 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 48.24 
18361515R.GYSFTTTAER.E566.75 (observed)2   peptide delta score: 40.87 
18361515R.GYSFTTTAER.E566.75 (observed)2   peptide delta score: 40.87 
18361515R.GYSFTTTAER.E566.75 (observed)2   peptide delta score: 40.87 
18361515R.GYSFTTTAER.E566.74 (observed)2   peptide delta score: 45.35 
18361515R.GYSFTTTAER.E566.74 (observed)2   peptide delta score: 45.35 
18361515R.GYSFTTTAER.E566.74 (observed)2   peptide delta score: 45.35 
18361515R.GYSFTTTAER.E566.73 (observed)2   peptide delta score: 40.93 
18361515R.GYSFTTTAER.E566.73 (observed)2   peptide delta score: 40.93 
18361515R.GYSFTTTAER.E566.73 (observed)2   peptide delta score: 40.93 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 36.67 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 36.67 
18361515R.GYSFTTTAER.E566.72 (observed)2   peptide delta score: 36.67 
18361515R.HQGVMVGMGQK.D391.22 (observed)3   peptide delta score: 31.24 
18361515R.HQGVMVGMGQK.D391.25 (observed)3   peptide delta score: 35.6 
18361515R.HQGVMVGMGQK.D391.22 (observed)3   peptide delta score: 22.87 
18361515R.LDLAGRDLTDYLMK.I541.9 (observed)3   peptide delta score: 33.12 
18361515R.LDLAGRDLTDYLMK.I541.9 (observed)3   peptide delta score: 33.12 
18361515R.LDLAGRDLTDYLMK.I541.9 (observed)3   peptide delta score: 33.12 
18361515R.MQKEITALAPSTMK.I516.9 (observed)3   peptide delta score: 23.39 
18361515R.MQKEITALAPSTMK.I516.9 (observed)3   peptide delta score: 23.39 
18361515R.MQKEITALAPSTMK.I516.9 (observed)3   peptide delta score: 23.39 
18361515R.MQKEITALAPSTMK.I516.9 (observed)3   peptide delta score: 23.39 
18361515R.MQKEITALAPSTMK.I516.91 (observed)3   peptide delta score: 32.18 
18361515R.MQKEITALAPSTMK.I516.91 (observed)3   peptide delta score: 32.18 
18361515R.MQKEITALAPSTMK.I516.91 (observed)3   peptide delta score: 32.18 
18361515R.MQKEITALAPSTMK.I516.91 (observed)3   peptide delta score: 32.18 
18361515R.VAPEEHPVLLTEAPLNPK.A652.05 (observed)3   peptide delta score: 38.6 
18361515R.VAPEEHPVLLTEAPLNPK.A652.06 (observed)3   peptide delta score: 25.97 
18361515R.VAPEEHPVLLTEAPLNPK.A652.07 (observed)3   peptide delta score: 42.04 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 28.05 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 34.44 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 28.42 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 37.91 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 49.7 
18361515R.VAPEEHPVLLTEAPLNPK.A652.06 (observed)3   peptide delta score: 32.52 
18361515K.AGFAGDDAPR.A488.67 (observed)2   peptide delta score: 56.49 
18361515K.AGFAGDDAPR.A488.67 (observed)2   peptide delta score: 56.49 
18361515K.AGFAGDDAPR.A488.67 (observed)2   peptide delta score: 56.49 
18361515K.AGFAGDDAPR.A488.69 (observed)2   peptide delta score: 77.49 
18361515K.AGFAGDDAPR.A488.69 (observed)2   peptide delta score: 77.49 
18361515K.AGFAGDDAPR.A488.69 (observed)2   peptide delta score: 77.49 
18361515K.AGFAGDDAPR.A488.71 (observed)2   peptide delta score: 75.6 
18361515K.AGFAGDDAPR.A488.71 (observed)2   peptide delta score: 75.6 
18361515K.AGFAGDDAPR.A488.71 (observed)2   peptide delta score: 75.6 
18361515K.AGFAGDDAPR.A488.65 (observed)2   peptide delta score: 71.93 
18361515K.AGFAGDDAPR.A488.65 (observed)2   peptide delta score: 71.93 
18361515K.AGFAGDDAPR.A488.65 (observed)2   peptide delta score: 71.93 
18361515K.AGFAGDDAPR.A488.66 (observed)2   peptide delta score: 64.22 
18361515K.AGFAGDDAPR.A488.66 (observed)2   peptide delta score: 64.22 
18361515K.AGFAGDDAPR.A488.66 (observed)2   peptide delta score: 64.22 
18361515K.AGFAGDDAPR.A488.68 (observed)2   peptide delta score: 61.92 
18361515K.AGFAGDDAPR.A488.68 (observed)2   peptide delta score: 61.92 
18361515K.AGFAGDDAPR.A488.68 (observed)2   peptide delta score: 61.92 
18361515K.AGFAGDDAPR.A488.7 (observed)2   peptide delta score: 49.3 
18361515K.AGFAGDDAPR.A488.7 (observed)2   peptide delta score: 49.3 
18361515K.AGFAGDDAPR.A488.7 (observed)2   peptide delta score: 49.3 
18361515K.AGFAGDDAPR.A488.75 (observed)2   peptide delta score: 45.76 
18361515K.AGFAGDDAPR.A488.75 (observed)2   peptide delta score: 45.76 
18361515K.AGFAGDDAPR.A488.75 (observed)2   peptide delta score: 45.76 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 49.84 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 49.84 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 49.84 
18361515K.DSYVGDEAQSKR.G452.18 (observed)3   peptide delta score: 23.99 
18361515K.DSYVGDEAQSKR.G452.19 (observed)3   peptide delta score: 29.93 
18361515K.DSYVGDEAQSKR.G452.19 (observed)3   peptide delta score: 29.93 
18361515K.DSYVGDEAQSKR.G452.19 (observed)3   peptide delta score: 29.93 
18361515K.DSYVGDEAQSKR.G452.16 (observed)3   peptide delta score: 23.81 
18361515K.DSYVGDEAQSKR.G452.17 (observed)3   peptide delta score: 42.87 
18361515K.DSYVGDEAQSKR.G452.23 (observed)3   peptide delta score: 31.31 
18361515K.EITALAPSTMK.I589.25 (observed)2  Oxidation (M)peptide delta score: 33.09 
18361515K.EITALAPSTMK.I589.25 (observed)2  Oxidation (M)peptide delta score: 33.09 
18361515K.EITALAPSTMK.I589.25 (observed)2  Oxidation (M)peptide delta score: 33.09 
18361515K.EITALAPSTMK.I589.25 (observed)2  Oxidation (M)peptide delta score: 33.09 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 45.38 
18361515K.EITALAPSTMK.I589.26 (observed)2  Oxidation (M)peptide delta score: 42.12 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 45.38 
18361515K.EITALAPSTMK.I589.26 (observed)2  Oxidation (M)peptide delta score: 42.12 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 45.38 
18361515K.EITALAPSTMK.I589.26 (observed)2  Oxidation (M)peptide delta score: 42.12 
18361515K.EITALAPSTMK.I581.25 (observed)2   peptide delta score: 45.38 
18361515K.EITALAPSTMK.I589.26 (observed)2  Oxidation (M)peptide delta score: 42.12 
18361515K.EITALAPSTMK.I581.34 (observed)2   peptide delta score: 47.98 
18361515K.EITALAPSTMK.I589.34 (observed)2  Oxidation (M)peptide delta score: 51.91 
18361515K.EITALAPSTMK.I581.34 (observed)2   peptide delta score: 47.98 
18361515K.EITALAPSTMK.I589.34 (observed)2  Oxidation (M)peptide delta score: 51.91 
18361515K.EITALAPSTMK.I581.34 (observed)2   peptide delta score: 47.98 
18361515K.EITALAPSTMK.I589.34 (observed)2  Oxidation (M)peptide delta score: 51.91 
18361515K.EITALAPSTMK.I581.34 (observed)2   peptide delta score: 47.98 
18361515K.EITALAPSTMK.I589.34 (observed)2  Oxidation (M)peptide delta score: 51.91 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 41.79 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 41.79 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 41.79 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 24.74 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 24.74 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 24.74 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 25.46 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 25.46 
18361515K.IIAPPER.K398.21 (observed)2   peptide delta score: 25.46 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 34.87 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 34.87 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 20.88 
18361515K.IIAPPER.K398.2 (observed)2   peptide delta score: 20.88 
18361515K.IIAPPER.K398.26 (observed)2   peptide delta score: 43.31 
18361515K.IIAPPER.K398.26 (observed)2   peptide delta score: 43.31 
18361515K.IIAPPER.K398.26 (observed)2   peptide delta score: 43.31 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.13 (observed)3   peptide delta score: 47.84 
18361515K.MTQIMFETFNTPAMYVAIQAVLSLYASGR.T1085.13 (observed)3   peptide delta score: 47.84 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 63.6 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 63.6 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 63.6 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 63.6 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 39.43 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 39.43 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 39.43 
18361515K.QEYDESGPSIVHR.K506.19 (observed)3   peptide delta score: 39.43 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 29.45 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 29.45 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 29.45 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 29.45 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 55.56 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 55.56 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 55.56 
18361515K.QEYDESGPSIVHR.K506.2 (observed)3   peptide delta score: 55.56 
18361515K.QEYDESGPSIVHR.K506.21 (observed)3   peptide delta score: 21.51 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 61.07 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 61.07 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 61.07 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 61.07 
18361515K.QEYDESGPSIVHR.K506.17 (observed)3   peptide delta score: 57.27 
18361515K.QEYDESGPSIVHR.K506.17 (observed)3   peptide delta score: 57.27 
18361515K.QEYDESGPSIVHR.K506.17 (observed)3   peptide delta score: 57.27 
18361515K.QEYDESGPSIVHR.K506.17 (observed)3   peptide delta score: 57.27 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.84 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.84 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.84 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.84 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.47 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.47 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.47 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 38.47 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 33.77 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 33.77 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 33.77 
18361515K.QEYDESGPSIVHR.K506.16 (observed)3   peptide delta score: 33.77 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 31.48 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 31.48 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 31.48 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 57.98 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 57.98 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 57.98 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 62.13 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 62.13 
18361515K.SYELPDGQVITIGNER.F895.88 (observed)2   peptide delta score: 62.13 
18361515K.SYELPDGQVITIGNER.F895.91 (observed)2   peptide delta score: 55.38 
18361515K.SYELPDGQVITIGNER.F895.91 (observed)2   peptide delta score: 55.38 
18361515K.SYELPDGQVITIGNER.F895.91 (observed)2   peptide delta score: 55.38 
18361515K.SYELPDGQVITIGNER.F895.89 (observed)2   peptide delta score: 38.96 
18361515K.SYELPDGQVITIGNER.F895.89 (observed)2   peptide delta score: 38.96 
18361515K.SYELPDGQVITIGNER.F895.89 (observed)2   peptide delta score: 38.96 
18361515K.SYELPDGQVITIGNER.F895.85 (observed)2   peptide delta score: 58.19 
18361515K.SYELPDGQVITIGNER.F895.85 (observed)2   peptide delta score: 58.19 
18361515K.SYELPDGQVITIGNER.F895.85 (observed)2   peptide delta score: 58.19 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.84 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.84 
18361515K.SYELPDGQVITIGNER.F895.87 (observed)2   peptide delta score: 86.84 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 46.97 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 46.97 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.33 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 27.33 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 23.06 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 23.06 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 38.12 
18361515R.AVFPSIVGRPR.H400.2 (observed)3   peptide delta score: 38.12 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 39.28 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 39.28 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 31 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 31 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 28.87 
18361515R.AVFPSIVGRPR.H400.21 (observed)3   peptide delta score: 28.87 
18361515R.AVFPSIVGRPR.H400.18 (observed)3   peptide delta score: 32.99 
18361515R.AVFPSIVGRPR.H400.18 (observed)3   peptide delta score: 32.99 
18361515R.AVFPSIVGRPR.H400.19 (observed)3   peptide delta score: 29.98 
18361515R.AVFPSIVGRPR.H400.19 (observed)3   peptide delta score: 29.98 
18361515R.DLTDYLMK.I507.69 (observed)2  Oxidation (M)peptide delta score: 32.07 
18361515R.DLTDYLMK.I507.69 (observed)2  Oxidation (M)peptide delta score: 32.07 
18361515R.DLTDYLMK.I507.69 (observed)2  Oxidation (M)peptide delta score: 32.07 
18361515R.DLTDYLMK.I499.77 (observed)2   peptide delta score: 37.77 
18361515R.DLTDYLMK.I499.77 (observed)2   peptide delta score: 37.77 
18361515R.DLTDYLMK.I499.77 (observed)2   peptide delta score: 37.77 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 50.35 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 50.35 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 50.35 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 24.52 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 24.52 
18361515R.GYSFTTTAER.E566.68 (observed)2   peptide delta score: 42.49 
18361515R.GYSFTTTAER.E566.68 (observed)2   peptide delta score: 42.49 
18361515R.GYSFTTTAER.E566.68 (observed)2   peptide delta score: 42.49 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 46.48 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 46.48 
18361515R.GYSFTTTAER.E566.71 (observed)2   peptide delta score: 46.48 
18361515R.GYSFTTTAER.E566.79 (observed)2   peptide delta score: 45.57 
18361515R.GYSFTTTAER.E566.79 (observed)2   peptide delta score: 45.57 
18361515R.GYSFTTTAER.E566.79 (observed)2   peptide delta score: 45.57 
18361515R.HQGVMVGMGQK.D391.2 (observed)3   peptide delta score: 39.36 
18361515R.VAPEEHPVLLTEAPLNPK.A651.95 (observed)3   peptide delta score: 42.75 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 41.15 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 22.4 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 28.56 
18361515R.VAPEEHPVLLTEAPLNPK.A651.98 (observed)3   peptide delta score: 28.26 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 51.77 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 51.77 
18361515R.VAPEEHPVLLTEAPLNPK.A651.92 (observed)3   peptide delta score: 33.22 
18361515R.VAPEEHPVLLTEAPLNPK.A651.92 (observed)3   peptide delta score: 26.93 
18361515R.VAPEEHPVLLTEAPLNPK.A651.95 (observed)3   peptide delta score: 46.44 
18361515R.VAPEEHPVLLTEAPLNPK.A651.96 (observed)3   peptide delta score: 26.31 
18361515R.VAPEEHPVLLTEAPLNPK.A652.04 (observed)3   peptide delta score: 42.64 
18614015(K)AGFAGDDAPR(A)      peptide count: 85
18614015(K)CDVDIR(K)      peptide count: 5
18614015(K)CDVDIRK(D)      peptide count: 13
18614015(K)DLYANTVLSGGTTMYPGIADR(M)      peptide count: 9
18614015(K)DSYVGDEAQSK(R)      peptide count: 99
18614015(K)DSYVGDEAQSKR(G)      peptide count: 21
18614015(K)EITALAPSTMK(I)      peptide count: 82
18614015(K)IIAPPERK(Y)      peptide count: 50
18614015(K)IKIIAPPER(K)      peptide count: 2
18614015(K)IKIIAPPERK(Y)      peptide count: 1
18614015(K)IWHHTFYNELR(V)      peptide count: 34
18614015(K)LCYVALDFEQEMATAASSSSLEK(S)      peptide count: 6
18614015(K)MTQIMFETFNTPAMYVAIQAVLSLYASGR(T)      peptide count: 6
18614015(K)QEYDESGPSIVHR(K)      peptide count: 49
18614015(K)SYELPDGQVITIGNER(F)      peptide count: 51
18614015(R)AVFPSIVGRPR(H)      peptide count: 17
18614015(R)CPEALFQPSFLGMESCGIHETTFNSIMK(C)      peptide count: 1
18614015(R)DLTDYLMK(I)      peptide count: 65
18614015(R)EKMTQIMFETFNTPAMYVAIQAVLSLYASGR(T)      peptide count: 1
18614015(R)GILTLK(Y)      peptide count: 1
18614015(R)GYSFTTTAER(E)      peptide count: 47
18614015(R)HQGVMVGMGQK(D)      peptide count: 37
18614015(R)IIAPPER(D)      peptide count: 59
18614015(R)KDLYANTVLSGGTTMYPGIADR(M)      peptide count: 2
18614015(R)LDLAGR(D)      peptide count: 40
18614015(R)LDLAGRDLTDYLMK(I)      peptide count: 4
18614015(R)TTGIVMDSGDGVTHTVPIYEGYALPHAILR(L)      peptide count: 30
18614015(R)VAPEEHPVLLTEAPLNPK(A)      peptide count: 38
15253431DLYANTVLSGGTTMYPGIADR 2    
15253431IWHHTFYNELR 2   Pept_E (Sonar search): 4.50E-09 
21616181AGFAGDDAPR1120.55132 (observed)   N-Term(iTRAQ4plex)peptide count: 58
21616181AGFAGDDAPR1120.55425 (observed)   N-Term(iTRAQ4plex)peptide count: 31
21616181CDVDIR910.42395 (observed)   N-Term(iTRAQ4plex), C1(Methylthio)MS2 score: 32peptide count: 12
21616181CDVDIR910.42375 (observed)   N-Term(iTRAQ4plex), C1(Methylthio)MS2 score: 32peptide count: 6
21616181DLTDYLMK1286.69951 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 64
21616181DLTDYLMK1302.6895 (observed)   N-Term(iTRAQ4plex), M7(Oxidation), K8(iTRAQ4plex)peptide count: 31
21616181DLTDYLMK1286.69634 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 23
21616181DLTDYLMK1302.68157 (observed)   N-Term(iTRAQ4plex), M7(Oxidation), K8(iTRAQ4plex)MS2 score: 46peptide count: 12
21616181DLYANTVLSGGTTMYPGIADR2376.15964 (observed)   N-Term(iTRAQ4plex), N5(Deamidated), M14(Oxidation)peptide count: 169
21616181DLYANTVLSGGTTMYPGIADR2359.17363 (observed)   N-Term(iTRAQ4plex)peptide count: 143
21616181DLYANTVLSGGTTMYPGIADR2359.16997 (observed)   N-Term(iTRAQ4plex)peptide count: 142
21616181DLYANTVLSGGTTMYPGIADR2375.17197 (observed)   N-Term(iTRAQ4plex), M14(Oxidation)peptide count: 112
21616181DLYANTVLSGGTTMYPGIADR2503.27127 (observed)   N-Term(iTRAQ4plex), Y15(iTRAQ4plex)XCorr (Sequest): 4.62peptide count: 1
21616181DLYANTVLSGGTTMYPGIADR2360.18222 (observed)   N-Term(iTRAQ4plex), N5(Deamidated)peptide count: 13
21616181DSYVGDEAQSK1486.73699 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 4
21616181DSYVGDEAQSK1486.73039 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 3
21616181EITALAPSTMK1449.82463 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 132
21616181EITALAPSTMK1465.81828 (observed)   N-Term(iTRAQ4plex), M10(Oxidation), K11(iTRAQ4plex)peptide count: 37
21616181EITALAPSTMK1449.82744 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 72
21616181EITALAPSTMK1465.81987 (observed)   N-Term(iTRAQ4plex), M10(Oxidation), K11(iTRAQ4plex)peptide count: 27
21616181GILTLK932.64879 (observed)   N-Term(iTRAQ4plex), K6(iTRAQ4plex)MS2 score: 42peptide count: 5
21616181GILTLK932.6483 (observed)   N-Term(iTRAQ4plex), K6(iTRAQ4plex) peptide count: 1
21616181GYSFTTTAER1276.63201 (observed)   N-Term(iTRAQ4plex)peptide count: 100
21616181GYSFTTTAER1276.62895 (observed)   N-Term(iTRAQ4plex)peptide count: 66
21616181IDIAGR788.47521 (observed)   N-Term(iTRAQ4plex)MS2 score: 39peptide count: 3
21616181IIAPPER939.57543 (observed)   N-Term(iTRAQ4plex)MS2 score: 42peptide count: 9
21616181IIAPPER939.57713 (observed)   N-Term(iTRAQ4plex) peptide count: 4
21616181LCYVALDFEQEMATAASSSSLEK2843.34098 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), M12(Oxidation), K23(iTRAQ4plex)peptide count: 7
21616181LCYVALDFEQEMATAASSSSLEK2843.33768 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), M12(Oxidation), K23(iTRAQ4plex)peptide count: 7
21616181LCYVALDFEQEMATAASSSSLEK2827.3539 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), K23(iTRAQ4plex)peptide count: 6
21616181LCYVALDFEQEMATAASSSSLEK2827.34829 (observed)   N-Term(iTRAQ4plex), C2(Methylthio), K23(iTRAQ4plex)peptide count: 5
21616181SYELPDGQVITIGNER1934.99907 (observed)   N-Term(iTRAQ4plex)peptide count: 243
21616181SYELPDGQVITIGNER1934.99883 (observed)   N-Term(iTRAQ4plex)peptide count: 233
21616181VAPEEHPVLLTEAPLNPK2242.27549 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 4
21127740AGFAGDDAPR488.73 (observed)21.83E+0617.25 (HPLC [min or %B]) MS2 score: 31.01
21127740AGFAGDDAPR488.73 (observed)27.50E+0610.16 (HPLC [min or %B]) MS2 score: 68.46
21127740AGFAGDDAPR488.73 (observed)23.31E+0617.76 (HPLC [min or %B]) MS2 score: 78.67
21127740AGFAGDDAPR488.73 (observed)21.29E+0610.11 (HPLC [min or %B]) MS2 score: 44.25
21127740AGFAGDDAPR488.73 (observed)23.26E+0817.67 (HPLC [min or %B]) MS2 score: 77.42
21127740AGFAGDDAPR488.73 (observed)26.61E+0517.75 (HPLC [min or %B]) MS2 score: 34.13
21127740AGFAGDDAPR488.73 (observed)23.45E+0617.04 (HPLC [min or %B]) MS2 score: 54.4
21127740AGFAGDDAPR488.73 (observed)27.67E+054.72 (HPLC [min or %B]) MS2 score: 41.58
21127740AGFAGDDAPR488.73 (observed)26.76E+0517.31 (HPLC [min or %B]) MS2 score: 58.76
21127740AGFAGDDAPR488.73 (observed)29.39E+0610.4 (HPLC [min or %B]) MS2 score: 73.57
21127740AGFAGDDAPR488.73 (observed)24.18E+0610.45 (HPLC [min or %B]) MS2 score: 59.53
21127740AGFAGDDAPR488.73 (observed)26.97E+0618.12 (HPLC [min or %B]) MS2 score: 40.21
21127740AGFAGDDAPR488.73 (observed)21.87E+0617.45 (HPLC [min or %B]) MS2 score: 54.61
21127740AGFAGDDAPR488.73 (observed)21.38E+0716.84 (HPLC [min or %B]) MS2 score: 48.56
21127740AGFAGDDAPR488.73 (observed)21.52E+0617.99 (HPLC [min or %B]) MS2 score: 49.35
21127740AGFAGDDAPR488.73 (observed)22.13E+0511.81 (HPLC [min or %B]) MS2 score: 28.94
21127740AGFAGDDAPR488.73 (observed)24.32E+0512.82 (HPLC [min or %B]) MS2 score: 35.46
21127740AGFAGDDAPR488.73 (observed)24.00E+0513.84 (HPLC [min or %B]) MS2 score: 28.08
21127740AGFAGDDAPR488.73 (observed)21.28E+0512.34 (HPLC [min or %B]) MS2 score: 31.2
21127740AGFAGDDAPR488.73 (observed)25.96E+0513.36 (HPLC [min or %B]) MS2 score: 44.6
21127740AGFAGDDAPR488.73 (observed)21.75E+0614.38 (HPLC [min or %B]) MS2 score: 48.6
21127740AGFAGDDAPR488.73 (observed)21.78E+0614.21 (HPLC [min or %B]) MS2 score: 33.16
21127740AGFAGDDAPR488.73 (observed)21.31E+0512.62 (HPLC [min or %B]) MS2 score: 26.18
21127740AGFAGDDAPR488.73 (observed)23.60E+0513.64 (HPLC [min or %B]) MS2 score: 26.35
21127740AGFAGDDAPR488.73 (observed)26.34E+0514.67 (HPLC [min or %B]) MS2 score: 38.61
21127740AGFAGDDAPR488.73 (observed)21.15E+0512.78 (HPLC [min or %B]) MS2 score: 27.04
21127740AGFAGDDAPR488.73 (observed)28.24E+049.6 (HPLC [min or %B]) MS2 score: 24.91
21127740AGFAGDDAPR488.73 (observed)22.03E+0511.49 (HPLC [min or %B]) MS2 score: 27.68
21127740AGFAGDDAPR488.73 (observed)25.51E+0512.76 (HPLC [min or %B]) MS2 score: 27.56
21127740DSYVGDEAQSK599.76 (observed)22.07E+0614.85 (HPLC [min or %B]) MS2 score: 59.4
21127740DSYVGDEAQSK599.76 (observed)21.25E+0514.71 (HPLC [min or %B]) MS2 score: 41.88
21127740DSYVGDEAQSK599.76 (observed)21.73E+067.88 (HPLC [min or %B]) MS2 score: 69.75
21127740DSYVGDEAQSK599.76 (observed)23.79E+0715 (HPLC [min or %B]) MS2 score: 67.44
21127740DSYVGDEAQSK599.76 (observed)23.69E+0615.1 (HPLC [min or %B]) MS2 score: 57.75
21127740DSYVGDEAQSK599.76 (observed)22.59E+0514.97 (HPLC [min or %B]) MS2 score: 47.82
21127740DSYVGDEAQSK599.76 (observed)28.10E+058.69 (HPLC [min or %B]) MS2 score: 47.6
21127740DSYVGDEAQSK599.76 (observed)21.07E+0512.86 (HPLC [min or %B]) MS2 score: 30.16
21127740DSYVGDEAQSK599.77 (observed)21.69E+0514.44 (HPLC [min or %B]) MS2 score: 30.77
21127740DSYVGDEAQSK599.76 (observed)21.97E+068.27 (HPLC [min or %B]) MS2 score: 72.67
21127740DSYVGDEAQSK599.76 (observed)28.84E+0512.48 (HPLC [min or %B]) MS2 score: 65.11
21127740DSYVGDEAQSK599.76 (observed)22.39E+0513.5 (HPLC [min or %B]) MS2 score: 39.28
21127740DSYVGDEAQSK599.76 (observed)21.34E+0514.96 (HPLC [min or %B]) MS2 score: 25.47
21127740DSYVGDEAQSK599.76 (observed)21.23E+0714.93 (HPLC [min or %B]) MS2 score: 39.26
21127740DSYVGDEAQSK599.76 (observed)21.37E+068.53 (HPLC [min or %B]) MS2 score: 58.01
21127740DSYVGDEAQSK599.76 (observed)25.27E+0514.87 (HPLC [min or %B]) MS2 score: 59.51
21127740DSYVGDEAQSK599.77 (observed)21.64E+058.3 (HPLC [min or %B]) MS2 score: 39.16
21127740DSYVGDEAQSK599.76 (observed)21.29E+078.68 (HPLC [min or %B]) MS2 score: 84.84
21127740DSYVGDEAQSK599.76 (observed)27.89E+058.01 (HPLC [min or %B]) MS2 score: 62.6
21127740DSYVGDEAQSK599.77 (observed)21.19E+0615.05 (HPLC [min or %B]) MS2 score: 62.5
21127740DSYVGDEAQSK599.76 (observed)21.77E+0514.72 (HPLC [min or %B]) MS2 score: 27.07
21127740DSYVGDEAQSK599.76 (observed)24.84E+058.43 (HPLC [min or %B]) MS2 score: 54.73
21127740DSYVGDEAQSK599.76 (observed)21.13E+0615.33 (HPLC [min or %B]) MS2 score: 59.23
21127740DSYVGDEAQSK599.76 (observed)24.75E+0515.1 (HPLC [min or %B]) MS2 score: 60.44
21127740DSYVGDEAQSK599.76 (observed)21.86E+078.5 (HPLC [min or %B]) MS2 score: 71.4
21127740DSYVGDEAQSK599.77 (observed)21.16E+0514.65 (HPLC [min or %B]) MS2 score: 29.13
21127740DSYVGDEAQSK599.76 (observed)21.22E+0515.04 (HPLC [min or %B]) MS2 score: 54.35
21127740DSYVGDEAQSK599.76 (observed)25.01E+0515.25 (HPLC [min or %B]) MS2 score: 51.4
21127740DSYVGDEAQSK599.77 (observed)29.52E+058.62 (HPLC [min or %B]) MS2 score: 57.4
21127740DSYVGDEAQSK599.76 (observed)21.01E+068.35 (HPLC [min or %B]) MS2 score: 52.59
21127740DSYVGDEAQSK599.76 (observed)24.38E+058.49 (HPLC [min or %B]) MS2 score: 56.11
21127740DSYVGDEAQSK599.77 (observed)22.92E+057.88 (HPLC [min or %B]) MS2 score: 63.57
21127740DSYVGDEAQSK599.76 (observed)25.63E+058.85 (HPLC [min or %B]) MS2 score: 53.03
21127740DSYVGDEAQSK599.76 (observed)24.24E+0615.04 (HPLC [min or %B]) MS2 score: 54.85
21127740DSYVGDEAQSK599.76 (observed)22.47E+0615.22 (HPLC [min or %B]) MS2 score: 56.69
21127740EITALAPSTMK589.31 (observed)29.48E+044.13 (HPLC [min or %B])Oxidation (M)MS2 score: 35.22
21127740EITALAPSTMK589.31 (observed)28.46E+0411.17 (HPLC [min or %B])Oxidation (M)MS2 score: 30.42
21127740EITALAPSTMK589.31 (observed)23.27E+0513.9 (HPLC [min or %B])Oxidation (M)MS2 score: 34.64
21127740EITALAPSTMK589.31 (observed)24.95E+0514.93 (HPLC [min or %B])Oxidation (M)MS2 score: 25.29
21127740EITALAPSTMK589.31 (observed)25.08E+0515.95 (HPLC [min or %B])Oxidation (M)MS2 score: 33.93
21127740EITALAPSTMK589.31 (observed)25.10E+0516.96 (HPLC [min or %B])Oxidation (M)MS2 score: 28.41
21127740EITALAPSTMK589.31 (observed)26.84E+0518.03 (HPLC [min or %B])Oxidation (M)MS2 score: 24.15
21127740EITALAPSTMK589.31 (observed)26.09E+0517.79 (HPLC [min or %B])Oxidation (M)MS2 score: 45.25
21127740EITALAPSTMK581.31 (observed)22.05E+0622.47 (HPLC [min or %B]) MS2 score: 41.4
21127740EITALAPSTMK581.31 (observed)29.49E+0522.56 (HPLC [min or %B]) MS2 score: 47.42
21127740EITALAPSTMK589.31 (observed)23.56E+0518.01 (HPLC [min or %B])Oxidation (M)MS2 score: 40.81
21127740EITALAPSTMK581.31 (observed)21.04E+0622.09 (HPLC [min or %B]) MS2 score: 29.57
21127740EITALAPSTMK589.31 (observed)25.21E+0516.08 (HPLC [min or %B])Oxidation (M)MS2 score: 34.1
21127740EITALAPSTMK589.31 (observed)21.67E+0617.11 (HPLC [min or %B])Oxidation (M)MS2 score: 39.11
21127740EITALAPSTMK589.31 (observed)28.32E+0618.17 (HPLC [min or %B])Oxidation (M)MS2 score: 50.31
21127740EITALAPSTMK581.31 (observed)22.55E+0722.26 (HPLC [min or %B]) MS2 score: 51.03
21127740EITALAPSTMK589.31 (observed)22.02E+0618.21 (HPLC [min or %B])Oxidation (M)MS2 score: 47.11
21127740EITALAPSTMK589.31 (observed)23.33E+0618.35 (HPLC [min or %B])Oxidation (M)MS2 score: 30.49
21127740EITALAPSTMK589.31 (observed)21.16E+0617.4 (HPLC [min or %B])Oxidation (M)MS2 score: 46.17
21127740EITALAPSTMK581.31 (observed)23.42E+0622.15 (HPLC [min or %B]) MS2 score: 47.84
21127740EITALAPSTMK589.31 (observed)21.26E+0514.32 (HPLC [min or %B])Oxidation (M)MS2 score: 32.29
21127740EITALAPSTMK589.31 (observed)25.15E+0516.81 (HPLC [min or %B])Oxidation (M)MS2 score: 30.9
21127740EITALAPSTMK589.31 (observed)22.41E+0617.82 (HPLC [min or %B])Oxidation (M)MS2 score: 40.32
21127740EITALAPSTMK581.31 (observed)29.46E+0622.36 (HPLC [min or %B]) MS2 score: 43.11
21127740EITALAPSTMK589.31 (observed)21.53E+0621.11 (HPLC [min or %B])Oxidation (M)MS2 score: 31.66
21127740EITALAPSTMK589.31 (observed)24.42E+0521.68 (HPLC [min or %B])Oxidation (M)MS2 score: 35.27
21127740EITALAPSTMK589.31 (observed)21.22E+0613.84 (HPLC [min or %B])Oxidation (M)MS2 score: 36.58
21127740EITALAPSTMK589.31 (observed)23.98E+0513.79 (HPLC [min or %B])Oxidation (M)MS2 score: 38.18
21127740EITALAPSTMK589.31 (observed)21.38E+0721.68 (HPLC [min or %B])Oxidation (M)MS2 score: 31.74
21127740EITALAPSTMK589.31 (observed)22.25E+0613.58 (HPLC [min or %B])Oxidation (M)MS2 score: 43.74
21127740EITALAPSTMK581.31 (observed)21.76E+0625.54 (HPLC [min or %B]) MS2 score: 37.76
21127740EITALAPSTMK589.31 (observed)22.00E+0521.68 (HPLC [min or %B])Oxidation (M)MS2 score: 35.53
21127740EITALAPSTMK581.31 (observed)21.89E+0625.98 (HPLC [min or %B]) MS2 score: 48.12
21127740EITALAPSTMK589.31 (observed)21.42E+0614.39 (HPLC [min or %B])Oxidation (M)MS2 score: 35.89
21127740EITALAPSTMK589.31 (observed)21.25E+0621.7 (HPLC [min or %B])Oxidation (M)MS2 score: 31.57
21127740EITALAPSTMK589.31 (observed)22.30E+0614.36 (HPLC [min or %B])Oxidation (M)MS2 score: 48.73
21127740EITALAPSTMK589.31 (observed)25.27E+0613.49 (HPLC [min or %B])Oxidation (M)MS2 score: 41.85
21127740EITALAPSTMK589.31 (observed)25.05E+0613.55 (HPLC [min or %B])Oxidation (M)MS2 score: 33.81
21127740EITALAPSTMK589.31 (observed)22.75E+0513.25 (HPLC [min or %B])Oxidation (M)MS2 score: 32.39
21127740EITALAPSTMK589.31 (observed)23.47E+0614.31 (HPLC [min or %B])Oxidation (M)MS2 score: 48.87
21127740EITALAPSTMK589.31 (observed)27.90E+0621.18 (HPLC [min or %B])Oxidation (M)MS2 score: 40.04
21127740EITALAPSTMK589.31 (observed)26.21E+0621.29 (HPLC [min or %B])Oxidation (M)MS2 score: 42.9
21127740EITALAPSTMK589.31 (observed)22.06E+0721.89 (HPLC [min or %B])Oxidation (M)MS2 score: 35.95
21127740EITALAPSTMK589.31 (observed)27.78E+0521.22 (HPLC [min or %B])Oxidation (M)MS2 score: 45.9
21127740EITALAPSTMK589.31 (observed)23.79E+0720.86 (HPLC [min or %B])Oxidation (M)MS2 score: 34.78
21127740EITALAPSTMK589.31 (observed)23.30E+0613.36 (HPLC [min or %B])Oxidation (M)MS2 score: 36.06
21127740EITALAPSTMK589.31 (observed)23.72E+0721.06 (HPLC [min or %B])Oxidation (M)MS2 score: 42.58
21127740EITALAPSTMK589.31 (observed)21.16E+0721.16 (HPLC [min or %B])Oxidation (M)MS2 score: 27.12
21127740EITALAPSTMK581.31 (observed)23.95E+0625.26 (HPLC [min or %B]) MS2 score: 27.8
21127740EITALAPSTMK589.31 (observed)24.96E+0520.94 (HPLC [min or %B])Oxidation (M)MS2 score: 32.24
21127740EITALAPSTMK589.31 (observed)21.59E+0614.15 (HPLC [min or %B])Oxidation (M)MS2 score: 34.71
21127740EITALAPSTMK589.31 (observed)21.27E+0620.25 (HPLC [min or %B])Oxidation (M)MS2 score: 48.93
21127740EITALAPSTMK589.31 (observed)22.54E+0613.69 (HPLC [min or %B])Oxidation (M)MS2 score: 39.63
21127740EITALAPSTMK589.31 (observed)24.15E+0613.65 (HPLC [min or %B])Oxidation (M)MS2 score: 44.15
21127740EITALAPSTMK589.31 (observed)21.83E+0621.62 (HPLC [min or %B])Oxidation (M)MS2 score: 35.95
21127740EITALAPSTMK589.31 (observed)25.68E+0621.35 (HPLC [min or %B])Oxidation (M)MS2 score: 26.74
21127740EITALAPSTMK589.31 (observed)22.30E+0521.33 (HPLC [min or %B])Oxidation (M)MS2 score: 57.53
21127740EITALAPSTMK581.31 (observed)21.59E+0625.62 (HPLC [min or %B]) MS2 score: 40.81
21127740EITALAPSTMK589.31 (observed)27.55E+0525.85 (HPLC [min or %B])Oxidation (M)MS2 score: 43.65
21127740GYSFTTTAER566.77 (observed)23.36E+0511.66 (HPLC [min or %B]) MS2 score: 38.36
21127740GYSFTTTAER566.77 (observed)25.67E+0512.68 (HPLC [min or %B]) MS2 score: 52.66
21127740GYSFTTTAER566.77 (observed)29.61E+0513.69 (HPLC [min or %B]) MS2 score: 50.98
21127740GYSFTTTAER566.77 (observed)21.31E+0614.72 (HPLC [min or %B]) MS2 score: 52.66
21127740GYSFTTTAER566.77 (observed)29.39E+0515.76 (HPLC [min or %B]) MS2 score: 50.44
21127740GYSFTTTAER566.77 (observed)28.74E+0516.78 (HPLC [min or %B]) MS2 score: 44.41
21127740GYSFTTTAER566.77 (observed)28.92E+0517.81 (HPLC [min or %B]) MS2 score: 49.46
21127740GYSFTTTAER566.77 (observed)27.25E+0518.9 (HPLC [min or %B]) MS2 score: 53.69
21127740GYSFTTTAER566.77 (observed)28.14E+0519.97 (HPLC [min or %B]) MS2 score: 51.42
21127740GYSFTTTAER566.77 (observed)27.95E+0518.23 (HPLC [min or %B]) MS2 score: 27.19
21127740GYSFTTTAER566.77 (observed)23.12E+0619.27 (HPLC [min or %B]) MS2 score: 62.3
21127740GYSFTTTAER566.77 (observed)23.38E+0517.95 (HPLC [min or %B]) MS2 score: 43.29
21127740GYSFTTTAER566.77 (observed)25.58E+0518.98 (HPLC [min or %B]) MS2 score: 49.05
21127740GYSFTTTAER566.77 (observed)26.54E+0518.6 (HPLC [min or %B]) MS2 score: 38.66
21127740GYSFTTTAER566.77 (observed)28.97E+0619.6 (HPLC [min or %B]) MS2 score: 66.35
21127740GYSFTTTAER566.77 (observed)24.52E+0518.61 (HPLC [min or %B]) MS2 score: 44.04
21127740GYSFTTTAER566.77 (observed)21.17E+0514.25 (HPLC [min or %B]) MS2 score: 26.52
21127740GYSFTTTAER566.77 (observed)27.64E+0516.69 (HPLC [min or %B]) MS2 score: 33.04
21127740GYSFTTTAER566.77 (observed)21.76E+0617.72 (HPLC [min or %B]) MS2 score: 58.97
21127740GYSFTTTAER566.77 (observed)24.17E+0618.75 (HPLC [min or %B]) MS2 score: 62.39
21127740GYSFTTTAER566.77 (observed)23.42E+0619.53 (HPLC [min or %B]) MS2 score: 67.05
21127740GYSFTTTAER566.77 (observed)23.59E+0518.48 (HPLC [min or %B]) MS2 score: 36.56
21127740GYSFTTTAER566.77 (observed)22.19E+0619.47 (HPLC [min or %B]) MS2 score: 56.74
21127740GYSFTTTAER566.77 (observed)25.05E+0519.22 (HPLC [min or %B]) MS2 score: 31.98
21127740GYSFTTTAER566.77 (observed)21.72E+0618.63 (HPLC [min or %B]) MS2 score: 39.55
21127740GYSFTTTAER566.77 (observed)27.68E+0619.62 (HPLC [min or %B]) MS2 score: 62.91
21127740GYSFTTTAER566.77 (observed)21.38E+0618.28 (HPLC [min or %B]) MS2 score: 48.76
21127740GYSFTTTAER566.77 (observed)22.36E+0619.31 (HPLC [min or %B]) MS2 score: 54.88
21127740GYSFTTTAER566.77 (observed)21.61E+0512.49 (HPLC [min or %B]) MS2 score: 26.12
21127740GYSFTTTAER566.77 (observed)21.92E+0514.12 (HPLC [min or %B]) MS2 score: 35.83
21127740GYSFTTTAER566.77 (observed)27.44E+0515.15 (HPLC [min or %B]) MS2 score: 53.77
21127740GYSFTTTAER566.77 (observed)21.02E+0514.33 (HPLC [min or %B]) MS2 score: 37.14
21127740GYSFTTTAER566.77 (observed)21.73E+0516.81 (HPLC [min or %B]) MS2 score: 25.07
21127740GYSFTTTAER566.77 (observed)29.24E+0515.1 (HPLC [min or %B]) MS2 score: 27.13
21127740GYSFTTTAER566.77 (observed)22.73E+0520.03 (HPLC [min or %B]) MS2 score: 41.16
21127740GYSFTTTAER566.77 (observed)24.46E+0518.51 (HPLC [min or %B]) MS2 score: 29.11
21127740GYSFTTTAER566.77 (observed)25.07E+0518.59 (HPLC [min or %B]) MS2 score: 36.43
21127740GYSFTTTAER566.77 (observed)23.46E+0619.65 (HPLC [min or %B]) MS2 score: 62.64
21127740GYSFTTTAER566.77 (observed)28.15E+0518.83 (HPLC [min or %B]) MS2 score: 38.97
21127740GYSFTTTAER566.77 (observed)28.46E+0518.53 (HPLC [min or %B]) MS2 score: 50.14
21127740GYSFTTTAER566.77 (observed)24.53E+0518.32 (HPLC [min or %B]) MS2 score: 41.03
21127740GYSFTTTAER566.77 (observed)22.40E+0619.29 (HPLC [min or %B]) MS2 score: 60.42
21127740GYSFTTTAER566.77 (observed)21.29E+0618.72 (HPLC [min or %B]) MS2 score: 55.73
21127740GYSFTTTAER566.77 (observed)28.07E+0619.76 (HPLC [min or %B]) MS2 score: 64.62
21127740GYSFTTTAER566.77 (observed)21.12E+0517.91 (HPLC [min or %B]) MS2 score: 29.61
21127740GYSFTTTAER566.77 (observed)21.68E+0619.37 (HPLC [min or %B]) MS2 score: 56.58
21127740GYSFTTTAER566.77 (observed)23.38E+0519.72 (HPLC [min or %B]) MS2 score: 40.99
21127740GYSFTTTAER566.77 (observed)22.73E+0518.77 (HPLC [min or %B]) MS2 score: 41.62
21127740GYSFTTTAER566.77 (observed)21.46E+0514.9 (HPLC [min or %B]) MS2 score: 36.9
21127740GYSFTTTAER566.77 (observed)22.48E+0515.95 (HPLC [min or %B]) MS2 score: 37.56
21127740GYSFTTTAER566.77 (observed)22.12E+0518.15 (HPLC [min or %B]) MS2 score: 35.01
21127740GYSFTTTAER566.77 (observed)29.69E+0413.45 (HPLC [min or %B]) MS2 score: 53.49
21127740GYSFTTTAER566.77 (observed)29.58E+0414.74 (HPLC [min or %B]) MS2 score: 29.33
21127740GYSFTTTAER566.77 (observed)22.88E+0516.37 (HPLC [min or %B]) MS2 score: 33.98
21127740GYSFTTTAER566.77 (observed)22.55E+0517.44 (HPLC [min or %B]) MS2 score: 31.84
21127740GYSFTTTAER566.77 (observed)22.19E+0518.5 (HPLC [min or %B]) MS2 score: 36.47
21127740GYSFTTTAER566.77 (observed)22.00E+0512.99 (HPLC [min or %B]) MS2 score: 45.79
21127740GYSFTTTAER566.77 (observed)22.80E+0514.05 (HPLC [min or %B]) MS2 score: 34.82
21127740GYSFTTTAER566.77 (observed)22.73E+053.33 (HPLC [min or %B]) MS2 score: 54.87
21127740GYSFTTTAER566.77 (observed)21.96E+0512.06 (HPLC [min or %B]) MS2 score: 43.37
21127740GYSFTTTAER566.77 (observed)22.73E+0513.08 (HPLC [min or %B]) MS2 score: 30.27
21127740GYSFTTTAER566.77 (observed)23.07E+0514.12 (HPLC [min or %B]) MS2 score: 30.6
21127740GYSFTTTAER566.77 (observed)21.46E+0615.14 (HPLC [min or %B]) MS2 score: 56.86
21127740GYSFTTTAER566.77 (observed)21.43E+0514.71 (HPLC [min or %B]) MS2 score: 27.59
21127740GYSFTTTAER566.77 (observed)24.41E+0515.28 (HPLC [min or %B]) MS2 score: 41.41
21127740GYSFTTTAER566.77 (observed)21.22E+0722.71 (HPLC [min or %B]) MS2 score: 43.38
21127740GYSFTTTAER566.77 (observed)26.00E+0522.81 (HPLC [min or %B]) MS2 score: 59.15
21127740GYSFTTTAER566.76 (observed)21.62E+0722.79 (HPLC [min or %B]) MS2 score: 64.18
21127740GYSFTTTAER566.77 (observed)25.04E+0615.42 (HPLC [min or %B]) MS2 score: 45.41
21127740GYSFTTTAER566.77 (observed)22.05E+0715.68 (HPLC [min or %B]) MS2 score: 69.77
21127740GYSFTTTAER566.77 (observed)22.91E+0622.34 (HPLC [min or %B]) MS2 score: 52.98
21127740GYSFTTTAER566.77 (observed)23.68E+0522.6 (HPLC [min or %B]) MS2 score: 56.95
21127740GYSFTTTAER566.77 (observed)27.34E+0522.53 (HPLC [min or %B]) MS2 score: 33.06
21127740HQGVMVGMGQK396.53 (observed)31.05E+0611.52 (HPLC [min or %B])Oxidation (M)MS2 score: 26.02
21127740HQGVMVGMGQK391.2 (observed)31.00E+0616.78 (HPLC [min or %B]) MS2 score: 29.09
21127740HQGVMVGMGQK594.29 (observed)21.67E+0511.35 (HPLC [min or %B])Oxidation (M)MS2 score: 29.68
21127740HQGVMVGMGQK594.29 (observed)26.12E+0513.97 (HPLC [min or %B])Oxidation (M)MS2 score: 35.13
21127740HQGVMVGMGQK391.2 (observed)37.09E+0516.56 (HPLC [min or %B]) MS2 score: 29.32
21127740HQGVMVGMGQK586.29 (observed)24.04E+0516.57 (HPLC [min or %B]) MS2 score: 31.78
21127740HQGVMVGMGQK602.28 (observed)23.69E+064.39 (HPLC [min or %B])2 Oxidation (M)MS2 score: 34.11
21127740IIAPPER398.24 (observed)23.11E+0614.67 (HPLC [min or %B]) MS2 score: 24.23
21127740IIAPPER398.24 (observed)23.56E+0610.5 (HPLC [min or %B]) MS2 score: 23.76
21127740IIAPPER398.24 (observed)25.61E+0610.57 (HPLC [min or %B]) MS2 score: 28.91
21127740IIAPPER398.24 (observed)27.82E+0517.19 (HPLC [min or %B]) MS2 score: 23.25
21127740IIAPPER398.24 (observed)21.48E+0617.46 (HPLC [min or %B]) MS2 score: 24
21127740IIAPPER398.24 (observed)21.81E+0717.68 (HPLC [min or %B]) MS2 score: 27.84
21127740IIAPPER398.24 (observed)29.96E+0517.71 (HPLC [min or %B]) MS2 score: 27.5
21127740IIAPPER398.24 (observed)27.20E+0510.66 (HPLC [min or %B]) MS2 score: 23.87
21127740IIAPPER398.24 (observed)21.26E+0611 (HPLC [min or %B]) MS2 score: 23.16
21127740IIAPPER398.24 (observed)24.25E+0610.92 (HPLC [min or %B]) MS2 score: 24.34
21127740IIAPPER398.24 (observed)25.92E+0514.98 (HPLC [min or %B]) MS2 score: 25.85
21127740IIAPPER398.24 (observed)23.27E+0615.29 (HPLC [min or %B]) MS2 score: 24.49
21127740IIAPPER398.24 (observed)29.44E+0412.96 (HPLC [min or %B]) MS2 score: 23.18
21127740IIAPPER398.24 (observed)24.65E+0513.72 (HPLC [min or %B]) MS2 score: 27.92
21127740IIAPPER398.24 (observed)25.99E+0515.18 (HPLC [min or %B]) MS2 score: 23.63
21127740IIAPPER398.24 (observed)21.41E+0615.09 (HPLC [min or %B]) MS2 score: 28.04
21127740IIAPPER398.24 (observed)22.77E+0513.22 (HPLC [min or %B]) MS2 score: 27.06
21127740IIAPPER398.24 (observed)24.91E+0514.24 (HPLC [min or %B]) MS2 score: 23.43
21127740IIAPPER398.24 (observed)21.66E+0514.43 (HPLC [min or %B]) MS2 score: 26.33
21127740IIAPPER398.24 (observed)24.53E+0511.55 (HPLC [min or %B]) MS2 score: 23.51
21127740IIAPPER398.24 (observed)21.56E+0613.62 (HPLC [min or %B]) MS2 score: 27.9
21127740IIAPPER398.24 (observed)21.06E+0717.92 (HPLC [min or %B]) MS2 score: 28.58
21127740IIAPPER398.24 (observed)21.44E+0717.11 (HPLC [min or %B]) MS2 score: 23.9
21127740IIAPPER398.24 (observed)25.87E+0518 (HPLC [min or %B]) MS2 score: 24.14
21127740IIAPPER398.24 (observed)25.14E+0414.74 (HPLC [min or %B]) MS2 score: 24.97
21127740IIAPPER398.24 (observed)22.14E+0514.24 (HPLC [min or %B]) MS2 score: 22.54
21127740IIAPPER398.24 (observed)23.85E+0511.5 (HPLC [min or %B]) MS2 score: 26.73
21127740IIAPPER398.24 (observed)28.15E+0512.53 (HPLC [min or %B]) MS2 score: 23.35
21127740IIAPPER398.24 (observed)21.55E+0613.55 (HPLC [min or %B]) MS2 score: 28.11
21127740IIAPPER398.24 (observed)29.09E+0514.58 (HPLC [min or %B]) MS2 score: 27.51
21127740IIAPPER398.24 (observed)21.11E+0613.23 (HPLC [min or %B]) MS2 score: 27.23
21127740IIAPPER398.24 (observed)21.59E+0614.26 (HPLC [min or %B]) MS2 score: 27.96
21127740IIAPPER398.24 (observed)26.30E+0513.87 (HPLC [min or %B]) MS2 score: 23.55
21127740IIAPPER398.24 (observed)23.92E+0615 (HPLC [min or %B]) MS2 score: 28.61
21127740IWHHTFYNELR505.92 (observed)31.99E+0722.21 (HPLC [min or %B]) MS2 score: 48.43
21127740IWHHTFYNELR758.38 (observed)23.59E+0622.22 (HPLC [min or %B]) MS2 score: 49.61
21127740IWHHTFYNELR505.92 (observed)34.74E+0622.24 (HPLC [min or %B]) MS2 score: 40.15
21127740IWHHTFYNELR505.92 (observed)38.26E+0621.39 (HPLC [min or %B]) MS2 score: 47.5
21127740IWHHTFYNELR505.92 (observed)32.13E+0622.16 (HPLC [min or %B]) MS2 score: 32.58
21127740IWHHTFYNELR758.38 (observed)21.76E+0622.21 (HPLC [min or %B]) MS2 score: 36.38
21127740IWHHTFYNELR758.38 (observed)21.37E+0622.77 (HPLC [min or %B]) MS2 score: 51.57
21127740IWHHTFYNELR505.92 (observed)31.12E+0621.85 (HPLC [min or %B]) MS2 score: 34.44
21127740IWHHTFYNELR758.38 (observed)25.79E+0522.12 (HPLC [min or %B]) MS2 score: 34.68
21127740IWHHTFYNELR758.38 (observed)28.95E+0521.61 (HPLC [min or %B]) MS2 score: 37.29
21127740IWHHTFYNELR505.92 (observed)31.78E+0722 (HPLC [min or %B]) MS2 score: 33.64
21127740IWHHTFYNELR505.92 (observed)34.63E+0722.3 (HPLC [min or %B]) MS2 score: 52.2
21127740IWHHTFYNELR758.38 (observed)21.30E+0722.31 (HPLC [min or %B]) MS2 score: 51.8
21127740IWHHTFYNELR758.38 (observed)21.30E+0622.49 (HPLC [min or %B]) MS2 score: 39.69
21127740IWHHTFYNELR505.92 (observed)38.64E+0522.72 (HPLC [min or %B]) MS2 score: 28.34
21127740IWHHTFYNELR505.92 (observed)31.33E+0622.22 (HPLC [min or %B]) MS2 score: 31.65
21127740IWHHTFYNELR758.38 (observed)21.61E+0622.58 (HPLC [min or %B]) MS2 score: 47.57
21127740IWHHTFYNELR505.92 (observed)32.01E+0622.34 (HPLC [min or %B]) MS2 score: 30.88
21127740IWHHTFYNELR758.38 (observed)22.09E+0622.53 (HPLC [min or %B]) MS2 score: 43.46
21127740IWHHTFYNELR758.38 (observed)28.16E+0522.34 (HPLC [min or %B]) MS2 score: 47.13
21127740IWHHTFYNELR758.38 (observed)23.50E+0523.09 (HPLC [min or %B]) MS2 score: 31.58
21127740IWHHTFYNELR758.38 (observed)26.24E+0522.71 (HPLC [min or %B]) MS2 score: 46.14
21127740IWHHTFYNELR758.38 (observed)29.22E+0522.66 (HPLC [min or %B]) MS2 score: 37.81
21127740IWHHTFYNELR505.92 (observed)31.12E+0622.43 (HPLC [min or %B]) MS2 score: 51.45
21127740IWHHTFYNELR505.92 (observed)32.23E+0622.61 (HPLC [min or %B]) MS2 score: 41.78
21127740IWHHTFYNELR758.38 (observed)27.98E+0522.68 (HPLC [min or %B]) MS2 score: 40.14
21127740IWHHTFYNELR505.92 (observed)37.23E+0522.27 (HPLC [min or %B]) MS2 score: 38.08
21127740IWHHTFYNELR505.92 (observed)37.21E+0522.61 (HPLC [min or %B]) MS2 score: 42.69
21127740IWHHTFYNELR758.38 (observed)26.23E+0522.8 (HPLC [min or %B]) MS2 score: 28.66
21127740IWHHTFYNELR505.92 (observed)31.32E+0622.64 (HPLC [min or %B]) MS2 score: 33.1
21127740IWHHTFYNELR758.38 (observed)22.21E+0622.1 (HPLC [min or %B]) MS2 score: 32.3
21127740IWHHTFYNELR505.92 (observed)36.04E+0522.43 (HPLC [min or %B]) MS2 score: 30.89
21127740IWHHTFYNELR758.38 (observed)26.33E+0622.92 (HPLC [min or %B]) MS2 score: 39.14
21127740IWHHTFYNELR505.92 (observed)32.67E+0622.74 (HPLC [min or %B]) MS2 score: 38.22
21127740IWHHTFYNELR505.92 (observed)31.72E+0623.21 (HPLC [min or %B]) MS2 score: 27.71
21127740IWHHTFYNELR758.38 (observed)21.02E+0725.28 (HPLC [min or %B]) MS2 score: 42.13
21127740IWHHTFYNELR505.92 (observed)32.73E+0725.87 (HPLC [min or %B]) MS2 score: 30.89
21127740IWHHTFYNELR505.92 (observed)31.07E+0620.94 (HPLC [min or %B]) MS2 score: 31.04
21127740IWHHTFYNELR505.92 (observed)31.64E+0725.74 (HPLC [min or %B]) MS2 score: 32.51
21127740IWHHTFYNELR758.38 (observed)21.46E+0725.82 (HPLC [min or %B]) MS2 score: 51.02
21127740IWHHTFYNELR505.92 (observed)31.22E+0624.68 (HPLC [min or %B]) MS2 score: 29
21127740IWHHTFYNELR505.92 (observed)33.85E+0617.98 (HPLC [min or %B]) MS2 score: 45.38
21127740IWHHTFYNELR505.92 (observed)32.09E+0624.68 (HPLC [min or %B]) MS2 score: 41.91
21127740IWHHTFYNELR505.92 (observed)31.61E+0620.13 (HPLC [min or %B]) MS2 score: 43.4
21127740IWHHTFYNELR505.92 (observed)31.04E+0724.69 (HPLC [min or %B]) MS2 score: 34.29
21127740IWHHTFYNELR505.92 (observed)32.56E+0625.1 (HPLC [min or %B]) MS2 score: 46.47
21127740QEYDESGPSIVHR506.24 (observed)38.24E+0619.16 (HPLC [min or %B]) MS2 score: 34.16
21127740QEYDESGPSIVHR750.34 (observed)23.88E+0615.49 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 64.1
21127740QEYDESGPSIVHR506.24 (observed)34.95E+0518.98 (HPLC [min or %B]) MS2 score: 40.39
21127740QEYDESGPSIVHR750.34 (observed)23.50E+0523.64 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 45.02
21127740QEYDESGPSIVHR506.24 (observed)33.93E+0718.91 (HPLC [min or %B]) MS2 score: 31.61
21127740QEYDESGPSIVHR750.34 (observed)21.80E+0723.44 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 48.26
21127740QEYDESGPSIVHR758.85 (observed)21.78E+0612.46 (HPLC [min or %B]) MS2 score: 64.33
21127740QEYDESGPSIVHR506.24 (observed)37.90E+0619.3 (HPLC [min or %B]) MS2 score: 31.28
21127740QEYDESGPSIVHR506.24 (observed)36.09E+0612.82 (HPLC [min or %B]) MS2 score: 57.13
21127740QEYDESGPSIVHR758.86 (observed)21.91E+0612.94 (HPLC [min or %B]) MS2 score: 58.4
21127740QEYDESGPSIVHR750.34 (observed)22.31E+0616.47 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 67.85
21127740QEYDESGPSIVHR758.85 (observed)21.36E+0719.36 (HPLC [min or %B]) MS2 score: 54.78
21127740QEYDESGPSIVHR506.24 (observed)32.14E+0719.65 (HPLC [min or %B]) MS2 score: 31.24
21127740QEYDESGPSIVHR750.34 (observed)21.35E+0723.39 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 50.5
21127740QEYDESGPSIVHR506.24 (observed)36.96E+0512.68 (HPLC [min or %B]) MS2 score: 43.03
21127740QEYDESGPSIVHR506.24 (observed)35.85E+0513.12 (HPLC [min or %B]) MS2 score: 27.55
21127740QEYDESGPSIVHR506.24 (observed)39.09E+0518.74 (HPLC [min or %B]) MS2 score: 32.06
21127740QEYDESGPSIVHR750.34 (observed)23.07E+0523.18 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 49.59
21127740QEYDESGPSIVHR750.34 (observed)27.05E+0523.21 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 58.12
21127740QEYDESGPSIVHR506.24 (observed)39.81E+0513.03 (HPLC [min or %B]) MS2 score: 34.3
21127740QEYDESGPSIVHR750.34 (observed)27.37E+0516.83 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 48.53
21127740QEYDESGPSIVHR506.24 (observed)35.86E+0517.89 (HPLC [min or %B]) MS2 score: 53.92
21127740QEYDESGPSIVHR506.24 (observed)34.02E+0519.23 (HPLC [min or %B]) MS2 score: 27.72
21127740QEYDESGPSIVHR750.34 (observed)28.34E+0523.48 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 40.01
21127740QEYDESGPSIVHR506.24 (observed)33.17E+0512.53 (HPLC [min or %B]) MS2 score: 29.52
21127740QEYDESGPSIVHR750.34 (observed)24.02E+0516.59 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 29.73
21127740QEYDESGPSIVHR506.24 (observed)34.20E+0612.85 (HPLC [min or %B]) MS2 score: 47.92
21127740QEYDESGPSIVHR758.85 (observed)21.32E+0612.91 (HPLC [min or %B]) MS2 score: 50.57
21127740QEYDESGPSIVHR750.34 (observed)21.23E+0616.47 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 60.39
21127740QEYDESGPSIVHR506.24 (observed)31.80E+0619.47 (HPLC [min or %B]) MS2 score: 37.59
21127740QEYDESGPSIVHR758.86 (observed)21.20E+0619.63 (HPLC [min or %B]) MS2 score: 39.96
21127740QEYDESGPSIVHR750.34 (observed)21.34E+0623.97 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 66.87
21127740QEYDESGPSIVHR506.24 (observed)36.09E+0519.16 (HPLC [min or %B]) MS2 score: 46.74
21127740QEYDESGPSIVHR758.85 (observed)21.60E+0619.29 (HPLC [min or %B]) MS2 score: 46.12
21127740QEYDESGPSIVHR750.34 (observed)23.19E+0623.82 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 53.58
21127740QEYDESGPSIVHR506.24 (observed)31.46E+0718.95 (HPLC [min or %B]) MS2 score: 32.86
21127740QEYDESGPSIVHR758.85 (observed)25.07E+0519.09 (HPLC [min or %B]) MS2 score: 39.52
21127740QEYDESGPSIVHR750.34 (observed)22.89E+0623.64 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 53.05
21127740QEYDESGPSIVHR758.86 (observed)26.43E+0519.83 (HPLC [min or %B]) MS2 score: 50.45
21127740QEYDESGPSIVHR506.24 (observed)32.97E+0613.09 (HPLC [min or %B]) MS2 score: 36.51
21127740QEYDESGPSIVHR750.34 (observed)21.68E+0623.8 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 33.82
21127740QEYDESGPSIVHR506.24 (observed)32.73E+0612.63 (HPLC [min or %B]) MS2 score: 54.63
21127740QEYDESGPSIVHR758.86 (observed)23.00E+0612.72 (HPLC [min or %B]) MS2 score: 60.84
21127740QEYDESGPSIVHR506.24 (observed)33.50E+0519.02 (HPLC [min or %B]) MS2 score: 28.41
21127740QEYDESGPSIVHR750.34 (observed)22.92E+0523.37 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 51.96
21127740QEYDESGPSIVHR750.34 (observed)21.14E+0523.91 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 28.76
21127740QEYDESGPSIVHR506.24 (observed)31.22E+0613.18 (HPLC [min or %B]) MS2 score: 37.88
21127740QEYDESGPSIVHR750.34 (observed)23.94E+0516.98 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 35.69
21127740QEYDESGPSIVHR506.24 (observed)33.12E+0619.57 (HPLC [min or %B]) MS2 score: 38.67
21127740QEYDESGPSIVHR750.34 (observed)25.84E+0523.85 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 46.22
21127740QEYDESGPSIVHR506.24 (observed)34.85E+0513.25 (HPLC [min or %B]) MS2 score: 33.8
21127740QEYDESGPSIVHR506.24 (observed)34.84E+0513.21 (HPLC [min or %B]) MS2 score: 28.03
21127740QEYDESGPSIVHR750.34 (observed)25.31E+0516.73 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 59.42
21127740QEYDESGPSIVHR506.24 (observed)34.85E+0512.97 (HPLC [min or %B]) MS2 score: 32.96
21127740QEYDESGPSIVHR750.34 (observed)21.29E+0616.44 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 67.86
21127740QEYDESGPSIVHR750.34 (observed)21.46E+0616.36 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 53.86
21127740QEYDESGPSIVHR758.86 (observed)23.84E+0512.71 (HPLC [min or %B]) MS2 score: 26.21
21127740QEYDESGPSIVHR506.24 (observed)31.36E+0613.05 (HPLC [min or %B]) MS2 score: 31.08
21127740QEYDESGPSIVHR750.34 (observed)27.75E+0516.74 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 39.12
21127740QEYDESGPSIVHR506.24 (observed)31.06E+0713.75 (HPLC [min or %B]) MS2 score: 25.45
21127740QEYDESGPSIVHR750.34 (observed)22.78E+0617.22 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 63.1
21127740QEYDESGPSIVHR506.24 (observed)35.14E+0519.59 (HPLC [min or %B]) MS2 score: 32.08
21127740QEYDESGPSIVHR758.85 (observed)21.25E+0619.24 (HPLC [min or %B]) MS2 score: 45.76
21127740QEYDESGPSIVHR750.34 (observed)21.77E+0624.06 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 52.51
21127740QEYDESGPSIVHR750.34 (observed)22.23E+054.93 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 32.75
21127740QEYDESGPSIVHR750.34 (observed)22.18E+0517.93 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 25.76
21127740QEYDESGPSIVHR506.24 (observed)31.83E+0616.32 (HPLC [min or %B]) MS2 score: 37.32
21127740QEYDESGPSIVHR750.34 (observed)22.47E+0620.32 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 60.52
21127740QEYDESGPSIVHR758.86 (observed)22.15E+0516.18 (HPLC [min or %B]) MS2 score: 26.27
21127740QEYDESGPSIVHR750.34 (observed)23.74E+0519.13 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 27.07
21127740QEYDESGPSIVHR750.34 (observed)24.66E+0519.92 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 25.54
21127740QEYDESGPSIVHR758.86 (observed)28.07E+0516.65 (HPLC [min or %B]) MS2 score: 27.15
21127740QEYDESGPSIVHR750.34 (observed)21.16E+0620.19 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 31.46
21127740QEYDESGPSIVHR750.34 (observed)27.21E+0519.83 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 34.23
21127740QEYDESGPSIVHR758.86 (observed)24.82E+0515.7 (HPLC [min or %B]) MS2 score: 45.84
21127740QEYDESGPSIVHR506.24 (observed)32.75E+0616.07 (HPLC [min or %B]) MS2 score: 33.36
21127740QEYDESGPSIVHR750.34 (observed)26.12E+0518.82 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 45.5
21127740QEYDESGPSIVHR750.34 (observed)21.79E+0619.83 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 56.08
21127740QEYDESGPSIVHR506.24 (observed)31.23E+0716.37 (HPLC [min or %B]) MS2 score: 39.58
21127740QEYDESGPSIVHR758.86 (observed)29.10E+0616.41 (HPLC [min or %B]) MS2 score: 52.34
21127740QEYDESGPSIVHR750.34 (observed)23.87E+0620.29 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 54.8
21127740QEYDESGPSIVHR758.86 (observed)24.65E+0516.64 (HPLC [min or %B]) MS2 score: 44.7
21127740QEYDESGPSIVHR750.34 (observed)29.00E+0519.84 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 45.54
21127740QEYDESGPSIVHR750.34 (observed)26.97E+0520.02 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 44.4
21127740QEYDESGPSIVHR506.24 (observed)32.28E+0616.6 (HPLC [min or %B]) MS2 score: 37.91
21127740QEYDESGPSIVHR506.24 (observed)34.96E+0616.8 (HPLC [min or %B]) MS2 score: 39.34
21127740QEYDESGPSIVHR750.34 (observed)25.59E+0520.52 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 28.45
21127740QEYDESGPSIVHR506.24 (observed)31.51E+0616.43 (HPLC [min or %B]) MS2 score: 35.07
21127740QEYDESGPSIVHR750.34 (observed)27.80E+0520.06 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 39.95
21127740QEYDESGPSIVHR506.24 (observed)37.09E+0516.47 (HPLC [min or %B]) MS2 score: 40.44
21127740QEYDESGPSIVHR750.34 (observed)24.68E+0620.15 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 48.65
21127740QEYDESGPSIVHR750.34 (observed)21.81E+0514.78 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 35.79
21127740QEYDESGPSIVHR506.24 (observed)37.72E+0516.17 (HPLC [min or %B]) MS2 score: 32.18
21127740QEYDESGPSIVHR750.34 (observed)21.16E+0620.09 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 46.3
21127740QEYDESGPSIVHR506.24 (observed)31.08E+0616.16 (HPLC [min or %B]) MS2 score: 32
21127740QEYDESGPSIVHR758.86 (observed)23.51E+0516.24 (HPLC [min or %B]) MS2 score: 35.46
21127740QEYDESGPSIVHR758.85 (observed)23.14E+0516.32 (HPLC [min or %B]) MS2 score: 37.28
21127740QEYDESGPSIVHR506.24 (observed)31.21E+0616.42 (HPLC [min or %B]) MS2 score: 30.72
21127740QEYDESGPSIVHR750.34 (observed)23.23E+0519.73 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 45.63
21127740QEYDESGPSIVHR506.24 (observed)33.84E+0516.21 (HPLC [min or %B]) MS2 score: 25.32
21127740QEYDESGPSIVHR506.24 (observed)33.81E+0516.3 (HPLC [min or %B]) MS2 score: 42.59
21127740QEYDESGPSIVHR506.24 (observed)31.21E+0616.15 (HPLC [min or %B]) MS2 score: 27.42
21127740QEYDESGPSIVHR750.34 (observed)29.63E+0519.77 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 55
21127740QEYDESGPSIVHR506.24 (observed)34.43E+0516.06 (HPLC [min or %B]) MS2 score: 48.17
21127740QEYDESGPSIVHR758.85 (observed)28.01E+0516.13 (HPLC [min or %B]) MS2 score: 32.34
21127740QEYDESGPSIVHR750.34 (observed)28.64E+0519.77 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 55.65
21127740QEYDESGPSIVHR750.34 (observed)27.18E+0519.52 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 38.74
21127740QEYDESGPSIVHR506.24 (observed)37.19E+0416.03 (HPLC [min or %B]) MS2 score: 39.74
21127740QEYDESGPSIVHR758.86 (observed)26.69E+0516.36 (HPLC [min or %B]) MS2 score: 39.2
21127740QEYDESGPSIVHR750.34 (observed)25.79E+0520.23 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 37.54
21127740SYELPDGQVITIGNER895.95 (observed)21.62E+0628.35 (HPLC [min or %B]) MS2 score: 65.87
21127740SYELPDGQVITIGNER895.95 (observed)22.52E+0736.11 (HPLC [min or %B]) MS2 score: 61.36
21127740SYELPDGQVITIGNER895.95 (observed)22.22E+0525.77 (HPLC [min or %B]) MS2 score: 30.53
21127740SYELPDGQVITIGNER895.95 (observed)27.48E+0528.38 (HPLC [min or %B]) MS2 score: 57.69
21127740SYELPDGQVITIGNER896.44 (observed)22.42E+0529.55 (HPLC [min or %B])Deamidation (NQ)MS2 score: 54.57
21127740SYELPDGQVITIGNER895.95 (observed)24.59E+0632.85 (HPLC [min or %B]) MS2 score: 28.31
21127740SYELPDGQVITIGNER896.45 (observed)25.69E+0635.6 (HPLC [min or %B])Deamidation (NQ)MS2 score: 56.16
21127740SYELPDGQVITIGNER895.95 (observed)21.77E+0628.52 (HPLC [min or %B]) MS2 score: 88.88
21127740SYELPDGQVITIGNER895.95 (observed)26.24E+0635.65 (HPLC [min or %B]) MS2 score: 84.23
21127740SYELPDGQVITIGNER895.95 (observed)27.22E+0535.7 (HPLC [min or %B]) MS2 score: 67.51
21127740SYELPDGQVITIGNER895.95 (observed)22.45E+0528.8 (HPLC [min or %B]) MS2 score: 36.75
21127740SYELPDGQVITIGNER895.95 (observed)21.23E+0626.86 (HPLC [min or %B]) MS2 score: 62.57
21127740SYELPDGQVITIGNER895.95 (observed)23.51E+0528.52 (HPLC [min or %B]) MS2 score: 32.02
21127740SYELPDGQVITIGNER895.95 (observed)26.14E+0636.96 (HPLC [min or %B]) MS2 score: 71.22
21127740SYELPDGQVITIGNER895.95 (observed)24.82E+0535.7 (HPLC [min or %B]) MS2 score: 52.9
21127740SYELPDGQVITIGNER895.95 (observed)24.95E+0635.48 (HPLC [min or %B]) MS2 score: 91.08
21127740SYELPDGQVITIGNER895.95 (observed)22.21E+0631.31 (HPLC [min or %B]) MS2 score: 62.72
21127740SYELPDGQVITIGNER895.95 (observed)23.60E+0631.53 (HPLC [min or %B]) MS2 score: 78.4
21127740SYELPDGQVITIGNER895.95 (observed)24.70E+0631.51 (HPLC [min or %B]) MS2 score: 79.99
21127740SYELPDGQVITIGNER895.95 (observed)23.84E+0528.99 (HPLC [min or %B]) MS2 score: 61.51
21127740SYELPDGQVITIGNER895.95 (observed)21.06E+0737.06 (HPLC [min or %B]) MS2 score: 60.46
21127740SYELPDGQVITIGNER895.95 (observed)25.21E+0529.36 (HPLC [min or %B]) MS2 score: 64.36
21127740SYELPDGQVITIGNER895.95 (observed)27.61E+0536.03 (HPLC [min or %B]) MS2 score: 55.31
21127740SYELPDGQVITIGNER895.95 (observed)28.05E+0529.04 (HPLC [min or %B]) MS2 score: 59.34
21127740SYELPDGQVITIGNER895.95 (observed)21.30E+0636.43 (HPLC [min or %B]) MS2 score: 58.95
21127740SYELPDGQVITIGNER895.95 (observed)21.61E+0528.46 (HPLC [min or %B]) MS2 score: 32.27
21127740SYELPDGQVITIGNER895.95 (observed)21.37E+0628.61 (HPLC [min or %B]) MS2 score: 73.1
21127740SYELPDGQVITIGNER895.95 (observed)27.67E+0529.18 (HPLC [min or %B]) MS2 score: 70.2
21127740SYELPDGQVITIGNER895.95 (observed)21.97E+0629.28 (HPLC [min or %B]) MS2 score: 68.43
21127740SYELPDGQVITIGNER895.95 (observed)22.30E+0628.98 (HPLC [min or %B]) MS2 score: 46.45
21127740SYELPDGQVITIGNER895.95 (observed)21.94E+0631.74 (HPLC [min or %B]) MS2 score: 52.54
21127740SYELPDGQVITIGNER895.95 (observed)22.43E+0631.4 (HPLC [min or %B]) MS2 score: 60.34
21127740SYELPDGQVITIGNER895.95 (observed)21.59E+0631.26 (HPLC [min or %B]) MS2 score: 53.05
21127740SYELPDGQVITIGNER895.95 (observed)21.06E+0631.45 (HPLC [min or %B]) MS2 score: 79.42
21127740SYELPDGQVITIGNER895.95 (observed)23.67E+0631.71 (HPLC [min or %B]) MS2 score: 84.69
21127740SYELPDGQVITIGNER895.95 (observed)21.87E+0629.16 (HPLC [min or %B]) MS2 score: 41.65
21127740SYELPDGQVITIGNER597.64 (observed)31.19E+0631.68 (HPLC [min or %B]) MS2 score: 38.19
21127740SYELPDGQVITIGNER895.95 (observed)22.77E+0631.35 (HPLC [min or %B]) MS2 score: 73.72
21127740SYELPDGQVITIGNER895.95 (observed)24.07E+0632.04 (HPLC [min or %B]) MS2 score: 62.95
21127740SYELPDGQVITIGNER895.95 (observed)22.73E+0631.47 (HPLC [min or %B]) MS2 score: 69.01
21127740SYELPDGQVITIGNER895.95 (observed)21.11E+0632.34 (HPLC [min or %B]) MS2 score: 55.74
21127740SYELPDGQVITIGNER895.95 (observed)29.74E+0636.33 (HPLC [min or %B]) MS2 score: 57.56
21127740SYELPDGQVITIGNER895.95 (observed)21.52E+0636.11 (HPLC [min or %B]) MS2 score: 37.89
21127740SYELPDGQVITIGNER895.95 (observed)22.10E+0636.42 (HPLC [min or %B]) MS2 score: 57.03
21127740SYELPDGQVITIGNER895.95 (observed)22.57E+0635.74 (HPLC [min or %B]) MS2 score: 51.34
21127740SYELPDGQVITIGNER895.95 (observed)21.03E+0536.04 (HPLC [min or %B]) MS2 score: 42.49
21127740SYELPDGQVITIGNER895.95 (observed)21.29E+0631.67 (HPLC [min or %B]) MS2 score: 62
21127740SYELPDGQVITIGNER597.64 (observed)31.05E+0632.05 (HPLC [min or %B]) MS2 score: 70.74
21127740SYELPDGQVITIGNER895.95 (observed)22.92E+0629.55 (HPLC [min or %B]) MS2 score: 50.58
21127740SYELPDGQVITIGNER895.95 (observed)23.39E+0631.84 (HPLC [min or %B]) MS2 score: 68.43
21127740SYELPDGQVITIGNER895.95 (observed)23.19E+0631.77 (HPLC [min or %B]) MS2 score: 57.51
21127740SYELPDGQVITIGNER597.64 (observed)33.37E+0631.88 (HPLC [min or %B]) MS2 score: 45.15
21127740SYELPDGQVITIGNER895.95 (observed)28.79E+0629.19 (HPLC [min or %B]) MS2 score: 61.94
21127740SYELPDGQVITIGNER895.95 (observed)28.15E+0629.12 (HPLC [min or %B]) MS2 score: 72.46
21127740SYELPDGQVITIGNER597.64 (observed)31.19E+0731.72 (HPLC [min or %B]) MS2 score: 58.58
21127740SYELPDGQVITIGNER895.95 (observed)25.90E+0631.88 (HPLC [min or %B]) MS2 score: 64.55
21127740SYELPDGQVITIGNER895.95 (observed)24.54E+0631.77 (HPLC [min or %B]) MS2 score: 62.95
21127740SYELPDGQVITIGNER597.64 (observed)33.05E+0632.04 (HPLC [min or %B]) MS2 score: 52.31
21127740SYELPDGQVITIGNER896.45 (observed)22.47E+0632.69 (HPLC [min or %B])Deamidation (NQ)MS2 score: 49.25
21127740SYELPDGQVITIGNER895.95 (observed)21.30E+0531.54 (HPLC [min or %B]) MS2 score: 71.19
21127740SYELPDGQVITIGNER895.95 (observed)21.52E+0631.73 (HPLC [min or %B]) MS2 score: 63.54
21127740SYELPDGQVITIGNER895.95 (observed)26.30E+0531.21 (HPLC [min or %B]) MS2 score: 53.44
21127740SYELPDGQVITIGNER597.64 (observed)37.83E+0531.45 (HPLC [min or %B]) MS2 score: 38.15
21127740SYELPDGQVITIGNER895.95 (observed)21.52E+0631.49 (HPLC [min or %B]) MS2 score: 64.54
21127740SYELPDGQVITIGNER895.95 (observed)22.32E+0631.61 (HPLC [min or %B]) MS2 score: 79.66
21127740SYELPDGQVITIGNER896.44 (observed)21.70E+0631.32 (HPLC [min or %B])Deamidation (NQ)MS2 score: 49.55
21127740SYELPDGQVITIGNER895.95 (observed)22.59E+0631.37 (HPLC [min or %B]) MS2 score: 64.21
21127740SYELPDGQVITIGNER895.95 (observed)21.16E+0631.48 (HPLC [min or %B]) MS2 score: 54.04
21127740SYELPDGQVITIGNER895.95 (observed)22.85E+0531.46 (HPLC [min or %B]) MS2 score: 52.95
21127740SYELPDGQVITIGNER895.95 (observed)23.19E+0631.76 (HPLC [min or %B]) MS2 score: 75
21127740SYELPDGQVITIGNER895.95 (observed)21.42E+0628.1 (HPLC [min or %B]) MS2 score: 50.25
21127740SYELPDGQVITIGNER895.95 (observed)21.08E+0628.04 (HPLC [min or %B]) MS2 score: 67.1
21127740SYELPDGQVITIGNER895.95 (observed)24.63E+0527.96 (HPLC [min or %B]) MS2 score: 68.72
21127740SYELPDGQVITIGNER895.95 (observed)26.18E+0528.03 (HPLC [min or %B]) MS2 score: 79.78
21127740SYELPDGQVITIGNER895.95 (observed)23.82E+0531.8 (HPLC [min or %B]) MS2 score: 72.38
21127740SYELPDGQVITIGNER895.95 (observed)29.09E+0527.89 (HPLC [min or %B]) MS2 score: 53.19
21127740SYELPDGQVITIGNER895.95 (observed)24.84E+0627.83 (HPLC [min or %B]) MS2 score: 66.85
21127740SYELPDGQVITIGNER895.95 (observed)22.20E+0627.63 (HPLC [min or %B]) MS2 score: 76.03
21127740SYELPDGQVITIGNER895.95 (observed)24.36E+0627.73 (HPLC [min or %B]) MS2 score: 77.22
21127740SYELPDGQVITIGNER895.95 (observed)21.49E+0627.69 (HPLC [min or %B]) MS2 score: 63.06
21127740SYELPDGQVITIGNER895.95 (observed)22.17E+0627.59 (HPLC [min or %B]) MS2 score: 50.03
21127740SYELPDGQVITIGNER895.95 (observed)26.95E+0531.71 (HPLC [min or %B]) MS2 score: 48.37
21127740SYELPDGQVITIGNER597.63 (observed)33.85E+0527.84 (HPLC [min or %B]) MS2 score: 29.35
21127740SYELPDGQVITIGNER895.95 (observed)21.07E+0627.91 (HPLC [min or %B]) MS2 score: 71.6
21127740SYELPDGQVITIGNER895.95 (observed)22.88E+0527.93 (HPLC [min or %B]) MS2 score: 53.03
21127740SYELPDGQVITIGNER895.95 (observed)24.16E+0527.8 (HPLC [min or %B]) MS2 score: 62.59
21127740SYELPDGQVITIGNER895.95 (observed)24.99E+0527.87 (HPLC [min or %B]) MS2 score: 75.28
21127740SYELPDGQVITIGNER895.95 (observed)23.67E+0527.9 (HPLC [min or %B]) MS2 score: 53.67
21127740AGFAGDDAPR488.73 (observed)25.61E+0410.37 (HPLC [min or %B]) MS2 score: 29.65
21127740AGFAGDDAPR488.73 (observed)21.58E+0511.49 (HPLC [min or %B]) MS2 score: 41.73
21127740AGFAGDDAPR488.73 (observed)23.20E+0512.51 (HPLC [min or %B]) MS2 score: 46.12
21127740AGFAGDDAPR488.73 (observed)24.33E+0513.57 (HPLC [min or %B]) MS2 score: 57.39
21127740AGFAGDDAPR488.73 (observed)21.16E+0614.58 (HPLC [min or %B]) MS2 score: 51.91
21127740AGFAGDDAPR488.73 (observed)21.40E+0618.14 (HPLC [min or %B]) MS2 score: 66.77
21127740AGFAGDDAPR488.73 (observed)28.30E+0610.48 (HPLC [min or %B]) MS2 score: 58.79
21127740AGFAGDDAPR488.73 (observed)21.19E+0617.33 (HPLC [min or %B]) MS2 score: 56.1
21127740AGFAGDDAPR488.73 (observed)29.12E+0517.95 (HPLC [min or %B]) MS2 score: 44.53
21127740AGFAGDDAPR488.73 (observed)22.45E+0610.69 (HPLC [min or %B]) MS2 score: 59.22
21127740AGFAGDDAPR488.73 (observed)24.42E+0610.8 (HPLC [min or %B]) MS2 score: 71.12
21127740AGFAGDDAPR488.73 (observed)28.96E+0410.93 (HPLC [min or %B]) MS2 score: 32.07
21127740AGFAGDDAPR488.73 (observed)21.81E+0511.95 (HPLC [min or %B]) MS2 score: 28.02
21127740AGFAGDDAPR488.73 (observed)23.38E+0512.97 (HPLC [min or %B]) MS2 score: 34.75
21127740AGFAGDDAPR488.73 (observed)23.67E+0514.01 (HPLC [min or %B]) MS2 score: 50.24
21127740AGFAGDDAPR488.73 (observed)28.93E+0517.56 (HPLC [min or %B]) MS2 score: 52.81
21127740AGFAGDDAPR488.73 (observed)22.03E+0717.93 (HPLC [min or %B]) MS2 score: 70.14
21127740AGFAGDDAPR488.73 (observed)24.90E+0417.71 (HPLC [min or %B]) MS2 score: 31.64
21127740AGFAGDDAPR488.73 (observed)28.63E+048.9 (HPLC [min or %B]) MS2 score: 25.44
21127740AGFAGDDAPR488.73 (observed)22.60E+0511.02 (HPLC [min or %B]) MS2 score: 29.79
21127740AGFAGDDAPR488.73 (observed)24.46E+0512.07 (HPLC [min or %B]) MS2 score: 34.16
21127740AGFAGDDAPR488.73 (observed)25.68E+0513.09 (HPLC [min or %B]) MS2 score: 51.4
21127740AGFAGDDAPR488.73 (observed)21.28E+0512.93 (HPLC [min or %B]) MS2 score: 34.53
21127740AGFAGDDAPR488.73 (observed)22.38E+0514.03 (HPLC [min or %B]) MS2 score: 35.95
21127740AGFAGDDAPR488.73 (observed)21.85E+0512.39 (HPLC [min or %B]) MS2 score: 28.83
21127740AGFAGDDAPR488.73 (observed)23.09E+0614.39 (HPLC [min or %B]) MS2 score: 52.69
21127740AGFAGDDAPR488.73 (observed)27.78E+0514.21 (HPLC [min or %B]) MS2 score: 33.69
21127740AGFAGDDAPR488.73 (observed)28.26E+049.24 (HPLC [min or %B]) MS2 score: 32.72
21127740AGFAGDDAPR488.73 (observed)26.56E+0410.31 (HPLC [min or %B]) MS2 score: 25.1
21127740AGFAGDDAPR488.73 (observed)22.52E+0512.34 (HPLC [min or %B]) MS2 score: 41.81
21127740AGFAGDDAPR488.73 (observed)23.36E+0513.39 (HPLC [min or %B]) MS2 score: 34.16
21127740AGFAGDDAPR488.73 (observed)29.84E+0412.62 (HPLC [min or %B]) MS2 score: 27.58
21127740AGFAGDDAPR488.73 (observed)21.28E+058.69 (HPLC [min or %B]) MS2 score: 31.81
21127740AGFAGDDAPR488.73 (observed)25.04E+063.24 (HPLC [min or %B]) MS2 score: 40.13
21127740AGFAGDDAPR488.73 (observed)28.57E+047.72 (HPLC [min or %B]) MS2 score: 29.27
21127740AGFAGDDAPR488.73 (observed)29.75E+049.7 (HPLC [min or %B]) MS2 score: 39.96
21127740AGFAGDDAPR488.73 (observed)23.49E+059.47 (HPLC [min or %B]) MS2 score: 33.9
21127740AGFAGDDAPR488.73 (observed)22.53E+059.72 (HPLC [min or %B]) MS2 score: 25.3
21127740AVFPSIVGRPR599.86 (observed)25.45E+0524.74 (HPLC [min or %B]) MS2 score: 28.12
21127740AVFPSIVGRPR599.86 (observed)22.21E+0624.34 (HPLC [min or %B]) MS2 score: 34.27
21127740AVFPSIVGRPR599.86 (observed)26.64E+0524.29 (HPLC [min or %B]) MS2 score: 29.31
21127740AVFPSIVGRPR599.86 (observed)29.53E+0524.34 (HPLC [min or %B]) MS2 score: 28.38
21127740AVFPSIVGRPR599.86 (observed)22.84E+0624.33 (HPLC [min or %B]) MS2 score: 38.48
21127740AVFPSIVGRPR599.85 (observed)23.35E+0627.38 (HPLC [min or %B]) MS2 score: 32.87
21127740AVFPSIVGRPR599.86 (observed)25.22E+0526.94 (HPLC [min or %B]) MS2 score: 38.06
21127740AVFPSIVGRPR599.85 (observed)21.91E+0620.59 (HPLC [min or %B]) MS2 score: 55.24
21127740AVFPSIVGRPR599.86 (observed)21.13E+0627.45 (HPLC [min or %B]) MS2 score: 44.08
21127740AVFPSIVGRPR599.86 (observed)28.64E+0519.57 (HPLC [min or %B]) MS2 score: 21.25
21127740AVFPSIVGRPR599.86 (observed)25.48E+0523.22 (HPLC [min or %B]) MS2 score: 38.83
21127740AVFPSIVGRPR599.86 (observed)21.10E+0623.56 (HPLC [min or %B]) MS2 score: 44.03
21127740CDVDIR389.18 (observed)25.62E+0716.81 (HPLC [min or %B]) MS2 score: 32.86
21127740CDVDIR389.18 (observed)28.66E+068.85 (HPLC [min or %B]) MS2 score: 30.58
21127740CDVDIR389.18 (observed)22.08E+069.3 (HPLC [min or %B]) MS2 score: 35.47
21127740DLTDYLMK507.74 (observed)21.71E+0725.74 (HPLC [min or %B])Oxidation (M)MS2 score: 32.18
21127740DLTDYLMK499.75 (observed)22.60E+0630.77 (HPLC [min or %B]) MS2 score: 30.79
21127740DLTDYLMK499.75 (observed)21.54E+0630.61 (HPLC [min or %B]) MS2 score: 28.77
21127740DLTDYLMK507.74 (observed)23.49E+0726.01 (HPLC [min or %B])Oxidation (M)MS2 score: 41.46
21127740DLTDYLMK507.74 (observed)29.82E+0626.01 (HPLC [min or %B])Oxidation (M)MS2 score: 33.6
21127740DLTDYLMK499.75 (observed)21.63E+0630.57 (HPLC [min or %B]) MS2 score: 26.52
21127740DLTDYLMK507.74 (observed)21.08E+0730.64 (HPLC [min or %B])Oxidation (M)MS2 score: 38.35
21127740DLTDYLMK507.74 (observed)27.85E+0630.22 (HPLC [min or %B])Oxidation (M)MS2 score: 25.24
21127740DLTDYLMK507.74 (observed)28.08E+0630.32 (HPLC [min or %B])Oxidation (M)MS2 score: 35.08
21127740DLTDYLMK507.74 (observed)21.21E+0730.66 (HPLC [min or %B])Oxidation (M)MS2 score: 35.55
21127740DLTDYLMK499.75 (observed)22.04E+0630.09 (HPLC [min or %B]) MS2 score: 38.51
21127740DLTDYLMK507.74 (observed)28.67E+0526.37 (HPLC [min or %B])Oxidation (M)MS2 score: 25.95
21127740DLTDYLMK507.74 (observed)21.01E+0625.72 (HPLC [min or %B])Oxidation (M)MS2 score: 24.61
21127740DLYANTVLSGGTTMYPGIADR1108.04 (observed)21.20E+0629.82 (HPLC [min or %B]) MS2 score: 55.82
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)21.75E+0627.22 (HPLC [min or %B])Oxidation (M)MS2 score: 98.38
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)23.51E+0627.27 (HPLC [min or %B])Oxidation (M)MS2 score: 95.48
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)23.40E+0527.5 (HPLC [min or %B])Oxidation (M)MS2 score: 65.6
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)22.68E+0535.05 (HPLC [min or %B])Oxidation (M)MS2 score: 82.62
21127740DLYANTVLSGGTTMYPGIADR1116.53 (observed)28.55E+0634.83 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 77.65
21127740DSYVGDEAQSK599.76 (observed)26.96E+0410.77 (HPLC [min or %B]) MS2 score: 26.63
21127740DSYVGDEAQSK599.76 (observed)21.88E+0511.84 (HPLC [min or %B]) MS2 score: 23.71
21127740DSYVGDEAQSK599.77 (observed)29.93E+0412.2 (HPLC [min or %B]) MS2 score: 37.42
21127740DSYVGDEAQSK599.76 (observed)24.30E+0511.15 (HPLC [min or %B]) MS2 score: 50.48
21127740DSYVGDEAQSK599.76 (observed)26.40E+0612.16 (HPLC [min or %B]) MS2 score: 69.54
21127740DSYVGDEAQSK599.77 (observed)22.96E+0613.26 (HPLC [min or %B]) MS2 score: 33.49
21127740DSYVGDEAQSK599.76 (observed)26.47E+0410.96 (HPLC [min or %B]) MS2 score: 22.15
21127740DSYVGDEAQSK599.77 (observed)21.92E+0511.86 (HPLC [min or %B]) MS2 score: 26.84
21127740DSYVGDEAQSK599.76 (observed)21.31E+0512.53 (HPLC [min or %B]) MS2 score: 31.84
21127740DSYVGDEAQSK599.76 (observed)24.59E+0511.97 (HPLC [min or %B]) MS2 score: 69.01
21127740DSYVGDEAQSK599.77 (observed)22.65E+0512.25 (HPLC [min or %B]) MS2 score: 47.07
21127740EITALAPSTMK589.31 (observed)21.28E+0618.06 (HPLC [min or %B])Oxidation (M)MS2 score: 33.94
21127740EITALAPSTMK589.31 (observed)29.80E+0518.19 (HPLC [min or %B])Oxidation (M)MS2 score: 42.91
21127740EITALAPSTMK589.31 (observed)25.73E+0517.37 (HPLC [min or %B])Oxidation (M)MS2 score: 31
21127740EITALAPSTMK589.31 (observed)21.31E+0618.37 (HPLC [min or %B])Oxidation (M)MS2 score: 25.9
21127740EITALAPSTMK581.31 (observed)24.73E+0521.82 (HPLC [min or %B]) MS2 score: 30.96
21127740EITALAPSTMK589.31 (observed)25.46E+0517.65 (HPLC [min or %B])Oxidation (M)MS2 score: 41.41
21127740EITALAPSTMK581.31 (observed)22.62E+0522.16 (HPLC [min or %B]) MS2 score: 48.81
21127740EITALAPSTMK589.31 (observed)28.03E+0517.27 (HPLC [min or %B])Oxidation (M)MS2 score: 42.01
21127740EITALAPSTMK589.31 (observed)21.62E+0618.29 (HPLC [min or %B])Oxidation (M)MS2 score: 35.45
21127740EITALAPSTMK589.31 (observed)21.21E+0516.93 (HPLC [min or %B])Oxidation (M)MS2 score: 30.57
21127740EITALAPSTMK589.31 (observed)23.83E+0516.81 (HPLC [min or %B])Oxidation (M)MS2 score: 31.68
21127740EITALAPSTMK589.31 (observed)29.62E+0416.26 (HPLC [min or %B])Oxidation (M)MS2 score: 36.85
21127740EITALAPSTMK589.31 (observed)24.72E+0517.24 (HPLC [min or %B])Oxidation (M)MS2 score: 32.18
21127740EITALAPSTMK589.31 (observed)21.63E+0617.46 (HPLC [min or %B])Oxidation (M)MS2 score: 46.85
21127740EITALAPSTMK589.31 (observed)22.90E+0515.01 (HPLC [min or %B])Oxidation (M)MS2 score: 30.49
21127740EITALAPSTMK589.31 (observed)25.10E+0516.05 (HPLC [min or %B])Oxidation (M)MS2 score: 36.03
21127740EITALAPSTMK589.31 (observed)21.68E+0617.07 (HPLC [min or %B])Oxidation (M)MS2 score: 33.82
21127740EITALAPSTMK589.31 (observed)21.63E+0617.43 (HPLC [min or %B])Oxidation (M)MS2 score: 45.45
21127740EITALAPSTMK589.31 (observed)23.99E+0516.86 (HPLC [min or %B])Oxidation (M)MS2 score: 30.67
21127740EITALAPSTMK581.31 (observed)26.31E+0521.8 (HPLC [min or %B]) MS2 score: 28.88
21127740EITALAPSTMK589.31 (observed)21.13E+0513.93 (HPLC [min or %B])Oxidation (M)MS2 score: 33.46
21127740EITALAPSTMK581.31 (observed)22.76E+0520.74 (HPLC [min or %B]) MS2 score: 32.49
21127740EITALAPSTMK581.31 (observed)24.66E+0521.74 (HPLC [min or %B]) MS2 score: 45.72
21127740GYSFTTTAER566.77 (observed)21.57E+0513.96 (HPLC [min or %B]) MS2 score: 32.3
21127740GYSFTTTAER566.77 (observed)24.19E+0723.28 (HPLC [min or %B]) MS2 score: 69.52
21127740GYSFTTTAER566.77 (observed)27.95E+0523.41 (HPLC [min or %B]) MS2 score: 62.51
21127740GYSFTTTAER566.77 (observed)27.64E+0522.63 (HPLC [min or %B]) MS2 score: 27.68
21127740GYSFTTTAER566.77 (observed)29.50E+0623.01 (HPLC [min or %B]) MS2 score: 50.24
21127740GYSFTTTAER566.77 (observed)22.60E+0515.4 (HPLC [min or %B]) MS2 score: 39.1
21127740GYSFTTTAER566.77 (observed)23.47E+0522.68 (HPLC [min or %B]) MS2 score: 62.34
21127740GYSFTTTAER566.77 (observed)22.96E+0515.01 (HPLC [min or %B]) MS2 score: 36.67
21127740GYSFTTTAER566.77 (observed)27.23E+0622.79 (HPLC [min or %B]) MS2 score: 54.41
21127740GYSFTTTAER566.77 (observed)25.21E+0623.36 (HPLC [min or %B]) MS2 score: 56.33
21127740GYSFTTTAER566.77 (observed)25.08E+0518.63 (HPLC [min or %B]) MS2 score: 27.97
21127740GYSFTTTAER566.77 (observed)25.87E+0518.8 (HPLC [min or %B]) MS2 score: 29.46
21127740GYSFTTTAER566.77 (observed)22.23E+0517.84 (HPLC [min or %B]) MS2 score: 34.38
21127740GYSFTTTAER566.77 (observed)24.23E+0618.83 (HPLC [min or %B]) MS2 score: 55.76
21127740GYSFTTTAER566.77 (observed)22.11E+0518.84 (HPLC [min or %B]) MS2 score: 45.3
21127740GYSFTTTAER566.77 (observed)23.75E+0519.15 (HPLC [min or %B]) MS2 score: 41.34
21127740GYSFTTTAER566.77 (observed)21.08E+0618.32 (HPLC [min or %B]) MS2 score: 44.24
21127740GYSFTTTAER566.77 (observed)21.47E+0619.08 (HPLC [min or %B]) MS2 score: 53.62
21127740GYSFTTTAER566.77 (observed)23.48E+0618.62 (HPLC [min or %B]) MS2 score: 56.88
21127740GYSFTTTAER566.77 (observed)25.55E+0519.2 (HPLC [min or %B]) MS2 score: 47.41
21127740GYSFTTTAER566.76 (observed)21.34E+0618.6 (HPLC [min or %B]) MS2 score: 39.55
21127740GYSFTTTAER566.77 (observed)24.83E+0518.46 (HPLC [min or %B]) MS2 score: 26.06
21127740GYSFTTTAER566.77 (observed)26.88E+0418.94 (HPLC [min or %B]) MS2 score: 30.15
21127740GYSFTTTAER566.77 (observed)21.10E+0519.29 (HPLC [min or %B]) MS2 score: 40.05
21127740GYSFTTTAER566.77 (observed)26.61E+0618.68 (HPLC [min or %B]) MS2 score: 53.51
21127740GYSFTTTAER566.77 (observed)27.95E+0618.65 (HPLC [min or %B]) MS2 score: 52.51
21127740GYSFTTTAER566.77 (observed)23.60E+0518.78 (HPLC [min or %B]) MS2 score: 33.97
21127740GYSFTTTAER566.76 (observed)27.28E+043.51 (HPLC [min or %B]) MS2 score: 25.22
21127740GYSFTTTAER566.77 (observed)27.78E+0412.6 (HPLC [min or %B]) MS2 score: 27.71
21127740GYSFTTTAER566.77 (observed)23.18E+0514.82 (HPLC [min or %B]) MS2 score: 47.58
21127740GYSFTTTAER566.77 (observed)25.74E+0518.79 (HPLC [min or %B]) MS2 score: 30.85
21127740GYSFTTTAER566.77 (observed)27.34E+0518.99 (HPLC [min or %B]) MS2 score: 40.42
21127740GYSFTTTAER566.77 (observed)21.50E+0618.91 (HPLC [min or %B]) MS2 score: 46.79
21127740HQGVMVGMGQK594.29 (observed)24.12E+0511.95 (HPLC [min or %B])Oxidation (M)MS2 score: 50.86
21127740HQGVMVGMGQK594.29 (observed)24.90E+0514.41 (HPLC [min or %B])Oxidation (M)MS2 score: 34.68
21127740HQGVMVGMGQK586.29 (observed)27.32E+0517.3 (HPLC [min or %B]) MS2 score: 31.27
21127740HQGVMVGMGQK602.28 (observed)25.33E+058.14 (HPLC [min or %B])2 Oxidation (M)MS2 score: 27.11
21127740HQGVMVGMGQK594.29 (observed)21.60E+069.93 (HPLC [min or %B])Oxidation (M)MS2 score: 39.44
21127740HQGVMVGMGQK594.29 (observed)28.14E+0612.01 (HPLC [min or %B])Oxidation (M)MS2 score: 48.42
21127740IIAPPER398.24 (observed)25.80E+0618.07 (HPLC [min or %B]) MS2 score: 28.56
21127740IIAPPER398.24 (observed)28.28E+0518.44 (HPLC [min or %B]) MS2 score: 24.54
21127740IIAPPER398.24 (observed)22.22E+0610.21 (HPLC [min or %B]) MS2 score: 24.54
21127740IIAPPER398.24 (observed)27.24E+0611.17 (HPLC [min or %B]) MS2 score: 25.27
21127740IIAPPER398.24 (observed)21.16E+0610.9 (HPLC [min or %B]) MS2 score: 23.9
21127740IIAPPER398.24 (observed)21.16E+0711.19 (HPLC [min or %B]) MS2 score: 24.56
21127740IIAPPER398.24 (observed)22.64E+0518.23 (HPLC [min or %B]) MS2 score: 22.63
21127740IIAPPER398.24 (observed)21.51E+0618.05 (HPLC [min or %B]) MS2 score: 23.76
21127740IIAPPER398.24 (observed)23.50E+0513.9 (HPLC [min or %B]) MS2 score: 26.66
21127740IIAPPER398.24 (observed)22.59E+0513.86 (HPLC [min or %B]) MS2 score: 26.54
21127740IIAPPER398.24 (observed)22.58E+0614.25 (HPLC [min or %B]) MS2 score: 23.02
21127740IIAPPER398.24 (observed)22.32E+0511.22 (HPLC [min or %B]) MS2 score: 21.01
21127740IIAPPER398.24 (observed)23.90E+0512.23 (HPLC [min or %B]) MS2 score: 26.78
21127740IIAPPER398.24 (observed)21.03E+0613.24 (HPLC [min or %B]) MS2 score: 27.62
21127740IIAPPER398.24 (observed)21.66E+0614.26 (HPLC [min or %B]) MS2 score: 28.12
21127740IIAPPER398.24 (observed)21.13E+0614.78 (HPLC [min or %B]) MS2 score: 28.07
21127740IIAPPER398.24 (observed)25.67E+0514.29 (HPLC [min or %B]) MS2 score: 27.84
21127740IIAPPER398.24 (observed)29.83E+0515.32 (HPLC [min or %B]) MS2 score: 28.06
21127740IIAPPER398.24 (observed)24.06E+0514.31 (HPLC [min or %B]) MS2 score: 27.13
21127740IIAPPER398.24 (observed)25.27E+059.6 (HPLC [min or %B]) MS2 score: 26.95
21127740IIAPPER398.24 (observed)21.27E+0611.66 (HPLC [min or %B]) MS2 score: 27.43
21127740IIAPPER398.24 (observed)21.80E+0612.69 (HPLC [min or %B]) MS2 score: 27.62
21127740IIAPPER398.24 (observed)28.72E+0614.07 (HPLC [min or %B]) MS2 score: 28.38
21127740IIAPPER398.24 (observed)21.20E+0611.69 (HPLC [min or %B]) MS2 score: 27.59
21127740IIAPPER398.24 (observed)22.22E+0510.73 (HPLC [min or %B]) MS2 score: 21.12
21127740IIAPPER398.24 (observed)21.78E+0510.69 (HPLC [min or %B]) MS2 score: 26.35
21127740IWHHTFYNELR505.92 (observed)33.78E+0625.84 (HPLC [min or %B]) MS2 score: 31.65
21127740IWHHTFYNELR505.92 (observed)32.81E+0720.45 (HPLC [min or %B]) MS2 score: 45.9
21127740IWHHTFYNELR758.38 (observed)24.46E+0620.47 (HPLC [min or %B]) MS2 score: 46.91
21127740IWHHTFYNELR505.92 (observed)31.35E+0625.39 (HPLC [min or %B]) MS2 score: 34.9
21127740IWHHTFYNELR505.92 (observed)31.57E+0625.37 (HPLC [min or %B]) MS2 score: 38.14
21127740IWHHTFYNELR505.92 (observed)31.27E+0626.91 (HPLC [min or %B]) MS2 score: 32.59
21127740IWHHTFYNELR758.38 (observed)24.07E+0526.8 (HPLC [min or %B]) MS2 score: 37.44
21127740IWHHTFYNELR505.92 (observed)31.20E+0725.29 (HPLC [min or %B]) MS2 score: 44.96
21127740IWHHTFYNELR758.38 (observed)24.02E+0625.36 (HPLC [min or %B]) MS2 score: 39.97
21127740IWHHTFYNELR505.92 (observed)31.13E+0622.46 (HPLC [min or %B]) MS2 score: 38.08
21127740IWHHTFYNELR758.38 (observed)28.03E+0522.03 (HPLC [min or %B]) MS2 score: 38.33
21127740IWHHTFYNELR505.92 (observed)31.07E+0621.04 (HPLC [min or %B]) MS2 score: 36.97
21127740IWHHTFYNELR505.92 (observed)36.75E+0622.12 (HPLC [min or %B]) MS2 score: 35.56
21127740IWHHTFYNELR758.38 (observed)21.04E+0622.14 (HPLC [min or %B]) MS2 score: 43.91
21127740IWHHTFYNELR758.38 (observed)28.55E+0521.72 (HPLC [min or %B]) MS2 score: 28.79
21127740IWHHTFYNELR505.92 (observed)31.86E+0622.24 (HPLC [min or %B]) MS2 score: 26.11
21127740IWHHTFYNELR505.92 (observed)31.36E+0621.42 (HPLC [min or %B]) MS2 score: 32.83
21127740IWHHTFYNELR758.37 (observed)21.02E+0622.42 (HPLC [min or %B]) MS2 score: 40.28
21127740IWHHTFYNELR758.38 (observed)23.12E+0522 (HPLC [min or %B]) MS2 score: 39.28
21127740IWHHTFYNELR758.37 (observed)23.95E+0522.66 (HPLC [min or %B]) MS2 score: 47.5
21127740IWHHTFYNELR758.38 (observed)24.28E+0517.8 (HPLC [min or %B]) MS2 score: 33.1
21127740IWHHTFYNELR758.38 (observed)21.84E+0621.75 (HPLC [min or %B]) MS2 score: 49.08
21127740IWHHTFYNELR505.92 (observed)32.40E+0621.52 (HPLC [min or %B]) MS2 score: 35.73
21127740IWHHTFYNELR758.38 (observed)25.82E+0517.55 (HPLC [min or %B]) MS2 score: 29.23
21127740IWHHTFYNELR505.92 (observed)31.89E+0621.57 (HPLC [min or %B]) MS2 score: 30.22
21127740IWHHTFYNELR758.38 (observed)21.72E+0621.67 (HPLC [min or %B]) MS2 score: 45.51
21127740IWHHTFYNELR505.92 (observed)33.16E+0621.75 (HPLC [min or %B]) MS2 score: 29.63
21127740IWHHTFYNELR505.92 (observed)35.92E+0522.21 (HPLC [min or %B]) MS2 score: 26.75
21127740IWHHTFYNELR505.92 (observed)38.56E+0521.84 (HPLC [min or %B]) MS2 score: 34.39
21127740IWHHTFYNELR505.92 (observed)31.47E+0621.89 (HPLC [min or %B]) MS2 score: 40.11
21127740IWHHTFYNELR758.38 (observed)24.35E+0518.18 (HPLC [min or %B]) MS2 score: 38.18
21127740IWHHTFYNELR505.92 (observed)31.24E+0617.41 (HPLC [min or %B]) MS2 score: 37.87
21127740IWHHTFYNELR758.38 (observed)26.85E+0517.73 (HPLC [min or %B]) MS2 score: 38.25
21127740IWHHTFYNELR505.92 (observed)32.18E+0618.66 (HPLC [min or %B]) MS2 score: 30.56
21127740IWHHTFYNELR505.92 (observed)39.40E+0521.37 (HPLC [min or %B]) MS2 score: 31.31
21127740IWHHTFYNELR758.38 (observed)23.30E+0621.4 (HPLC [min or %B]) MS2 score: 39.57
21127740IWHHTFYNELR505.92 (observed)37.36E+0518.81 (HPLC [min or %B]) MS2 score: 30.58
21127740IWHHTFYNELR758.38 (observed)21.72E+0518.77 (HPLC [min or %B]) MS2 score: 34.71
21127740KDLYANTVLSGGTTMYPGIADR787.39 (observed)34.20E+0627.52 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 73.07
21127740KDLYANTVLSGGTTMYPGIADR787.39 (observed)34.31E+0627.05 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 57.27
21127740KDLYANTVLSGGTTMYPGIADR1180.58 (observed)21.30E+0727.14 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 57.34
21127740KDLYANTVLSGGTTMYPGIADR787.39 (observed)32.69E+0627.24 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 42.89
21127740QEYDESGPSIVHR506.24 (observed)34.12E+0513.2 (HPLC [min or %B]) MS2 score: 25.5
21127740QEYDESGPSIVHR758.85 (observed)21.96E+0512.32 (HPLC [min or %B]) MS2 score: 25.22
21127740QEYDESGPSIVHR750.34 (observed)27.06E+0516.42 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 33.67
21127740QEYDESGPSIVHR750.34 (observed)23.59E+0516.54 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 25.26
21127740QEYDESGPSIVHR506.24 (observed)33.70E+0513.12 (HPLC [min or %B]) MS2 score: 25.88
21127740QEYDESGPSIVHR750.34 (observed)25.55E+0516.74 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 40.07
21127740QEYDESGPSIVHR758.85 (observed)23.27E+0516.36 (HPLC [min or %B]) MS2 score: 33.86
21127740QEYDESGPSIVHR506.24 (observed)31.21E+0615.88 (HPLC [min or %B]) MS2 score: 39.06
21127740QEYDESGPSIVHR750.34 (observed)24.26E+0519.58 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 36.07
21127740QEYDESGPSIVHR750.34 (observed)28.29E+0520.01 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 51.15
21127740QEYDESGPSIVHR506.24 (observed)31.85E+0512.52 (HPLC [min or %B]) MS2 score: 26.91
21127740SYELPDGQVITIGNER895.95 (observed)21.26E+0531.66 (HPLC [min or %B]) MS2 score: 40.36
21127740SYELPDGQVITIGNER895.95 (observed)23.99E+0627.68 (HPLC [min or %B]) MS2 score: 65.13
21127740SYELPDGQVITIGNER895.95 (observed)26.40E+0531.72 (HPLC [min or %B]) MS2 score: 49.03
21127740SYELPDGQVITIGNER895.95 (observed)26.46E+0528.03 (HPLC [min or %B]) MS2 score: 52.13
21127740SYELPDGQVITIGNER895.95 (observed)28.30E+0528.12 (HPLC [min or %B]) MS2 score: 61.12
21127740SYELPDGQVITIGNER895.95 (observed)24.89E+0528.1 (HPLC [min or %B]) MS2 score: 57.24
21127740SYELPDGQVITIGNER895.95 (observed)23.90E+0527.99 (HPLC [min or %B]) MS2 score: 47.61
21127740SYELPDGQVITIGNER895.95 (observed)22.18E+0628.06 (HPLC [min or %B]) MS2 score: 63.16
21127740SYELPDGQVITIGNER895.95 (observed)21.04E+0628.13 (HPLC [min or %B]) MS2 score: 52.64
21127740SYELPDGQVITIGNER895.95 (observed)25.79E+0527.96 (HPLC [min or %B]) MS2 score: 48.22
21127740SYELPDGQVITIGNER895.95 (observed)27.55E+0527.68 (HPLC [min or %B]) MS2 score: 59.75
21127740SYELPDGQVITIGNER895.95 (observed)21.35E+0627.84 (HPLC [min or %B]) MS2 score: 71.52
21127740SYELPDGQVITIGNER895.95 (observed)21.53E+0631.44 (HPLC [min or %B]) MS2 score: 75.09
21127740SYELPDGQVITIGNER895.95 (observed)21.29E+0631.35 (HPLC [min or %B]) MS2 score: 83.69
21127740SYELPDGQVITIGNER895.95 (observed)21.95E+0631.59 (HPLC [min or %B]) MS2 score: 52.4
21127740SYELPDGQVITIGNER895.95 (observed)22.26E+0631.62 (HPLC [min or %B]) MS2 score: 41.98
21127740SYELPDGQVITIGNER895.95 (observed)28.94E+0528.34 (HPLC [min or %B]) MS2 score: 31.49
21127740SYELPDGQVITIGNER597.64 (observed)38.79E+0527.96 (HPLC [min or %B]) MS2 score: 62.37
21127740SYELPDGQVITIGNER895.95 (observed)21.53E+0628.35 (HPLC [min or %B]) MS2 score: 71.69
21127740SYELPDGQVITIGNER597.64 (observed)34.95E+0528.05 (HPLC [min or %B]) MS2 score: 27.55
21127740SYELPDGQVITIGNER895.95 (observed)24.65E+0628.1 (HPLC [min or %B]) MS2 score: 73.93
21127740SYELPDGQVITIGNER895.95 (observed)23.60E+0631.21 (HPLC [min or %B]) MS2 score: 55.21
21127740SYELPDGQVITIGNER895.95 (observed)21.98E+0628.06 (HPLC [min or %B]) MS2 score: 47.43
21127740SYELPDGQVITIGNER895.95 (observed)21.07E+0531.63 (HPLC [min or %B]) MS2 score: 44.24
21127740SYELPDGQVITIGNER895.95 (observed)29.02E+0630.83 (HPLC [min or %B]) MS2 score: 53.97
21127740SYELPDGQVITIGNER597.63 (observed)33.17E+0631.06 (HPLC [min or %B]) MS2 score: 50.65
21127740SYELPDGQVITIGNER896.45 (observed)23.32E+0631.06 (HPLC [min or %B])Deamidation (NQ)MS2 score: 40.78
21127740SYELPDGQVITIGNER895.95 (observed)29.82E+0531.22 (HPLC [min or %B]) MS2 score: 85.68
21127740SYELPDGQVITIGNER895.95 (observed)23.58E+0628.12 (HPLC [min or %B]) MS2 score: 42.44
21127740SYELPDGQVITIGNER895.95 (observed)21.98E+0631.27 (HPLC [min or %B]) MS2 score: 73.88
21127740SYELPDGQVITIGNER895.95 (observed)21.78E+0631.55 (HPLC [min or %B]) MS2 score: 44.29
21127740SYELPDGQVITIGNER895.95 (observed)22.10E+0631.91 (HPLC [min or %B]) MS2 score: 54.33
21127740SYELPDGQVITIGNER895.95 (observed)26.96E+0531.21 (HPLC [min or %B]) MS2 score: 55.56
21127740SYELPDGQVITIGNER895.95 (observed)25.64E+0631.44 (HPLC [min or %B]) MS2 score: 56.48
21127740SYELPDGQVITIGNER895.95 (observed)22.53E+0631.78 (HPLC [min or %B]) MS2 score: 57.13
21127740SYELPDGQVITIGNER895.95 (observed)21.13E+0631.71 (HPLC [min or %B]) MS2 score: 56.12
21127740SYELPDGQVITIGNER895.95 (observed)21.09E+0631.66 (HPLC [min or %B]) MS2 score: 51.8
21127740SYELPDGQVITIGNER895.95 (observed)26.77E+0531.4 (HPLC [min or %B]) MS2 score: 56.53
21127740SYELPDGQVITIGNER895.95 (observed)21.83E+0631.37 (HPLC [min or %B]) MS2 score: 63.26
21127740SYELPDGQVITIGNER895.95 (observed)25.06E+0531.4 (HPLC [min or %B]) MS2 score: 62.09
21127740SYELPDGQVITIGNER895.95 (observed)21.65E+0631.45 (HPLC [min or %B]) MS2 score: 57.36
21127740SYELPDGQVITIGNER895.95 (observed)27.59E+0531.52 (HPLC [min or %B]) MS2 score: 52.75
21127740VAPEEHPVLLTEAPLNPK652.02 (observed)33.29E+0729.06 (HPLC [min or %B]) MS2 score: 40.72
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)22.38E+0622.61 (HPLC [min or %B]) MS2 score: 75.33
21127740VAPEEHPVLLTEAPLNPK652.02 (observed)33.69E+0729.19 (HPLC [min or %B]) MS2 score: 26.63
21127740VAPEEHPVLLTEAPLNPK977.53 (observed)27.64E+0522.61 (HPLC [min or %B]) MS2 score: 70.75
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)35.24E+0529.08 (HPLC [min or %B]) MS2 score: 27.25
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)37.01E+0522.85 (HPLC [min or %B]) MS2 score: 33.15
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)23.35E+0522.96 (HPLC [min or %B]) MS2 score: 33.42
21127740VAPEEHPVLLTEAPLNPK977.53 (observed)24.61E+0530.46 (HPLC [min or %B]) MS2 score: 38.54
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)31.03E+0629.32 (HPLC [min or %B]) MS2 score: 42.26
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)26.06E+0522.17 (HPLC [min or %B]) MS2 score: 53.51
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)33.12E+0622.82 (HPLC [min or %B]) MS2 score: 29.51
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.57E+0622.87 (HPLC [min or %B]) MS2 score: 39.18
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)28.06E+0522.96 (HPLC [min or %B]) MS2 score: 43.04
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.86E+0626.68 (HPLC [min or %B]) MS2 score: 53.79
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.53E+0626.34 (HPLC [min or %B]) MS2 score: 56.46
21127740VAPEEHPVLLTEAPLNPK652.02 (observed)35.44E+0629.59 (HPLC [min or %B]) MS2 score: 27.08
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)39.51E+0522.7 (HPLC [min or %B]) MS2 score: 37.24
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)22.51E+0522.76 (HPLC [min or %B]) MS2 score: 46.23
21127740VAPEEHPVLLTEAPLNPK977.53 (observed)21.06E+0630.54 (HPLC [min or %B]) MS2 score: 52.91
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)32.81E+0623.13 (HPLC [min or %B]) MS2 score: 25.48
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)33.56E+0522.51 (HPLC [min or %B]) MS2 score: 42.04
21127740VAPEEHPVLLTEAPLNPK652.02 (observed)33.29E+0626.55 (HPLC [min or %B]) MS2 score: 24.28
21127740VAPEEHPVLLTEAPLNPK977.53 (observed)23.55E+0626.7 (HPLC [min or %B]) MS2 score: 49.06
21127740VAPEEHPVLLTEAPLNPK978.03 (observed)28.75E+0626.1 (HPLC [min or %B])Deamidation (NQ)MS2 score: 33.82
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)33.25E+0626.18 (HPLC [min or %B]) MS2 score: 44.66
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.95E+0522.93 (HPLC [min or %B]) MS2 score: 59.19
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)25.08E+0523.04 (HPLC [min or %B]) MS2 score: 59.85
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)33.95E+0525.68 (HPLC [min or %B]) MS2 score: 22.65
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)22.84E+0525.95 (HPLC [min or %B]) MS2 score: 60.76
21127740VAPEEHPVLLTEAPLNPK977.53 (observed)28.94E+0526 (HPLC [min or %B]) MS2 score: 47.97
21127740VAPEEHPVLLTEAPLNPK652.36 (observed)32.22E+0625.71 (HPLC [min or %B])Deamidation (NQ)MS2 score: 29.85
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.85E+0622.68 (HPLC [min or %B]) MS2 score: 41.13
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)35.60E+0621.61 (HPLC [min or %B]) MS2 score: 35.73
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)22.78E+0525.97 (HPLC [min or %B]) MS2 score: 39.32
21127740AGFAGDDAPR488.73 (observed)25.01E+0610.11 (HPLC [min or %B]) MS2 score: 50.56
21127740AGFAGDDAPR488.73 (observed)24.89E+0514.12 (HPLC [min or %B]) MS2 score: 51.79
21127740AGFAGDDAPR488.73 (observed)24.97E+0414.04 (HPLC [min or %B]) MS2 score: 31.42
21127740AGFAGDDAPR488.73 (observed)21.38E+0510.63 (HPLC [min or %B]) MS2 score: 34.53
21127740AGFAGDDAPR488.73 (observed)23.97E+049.59 (HPLC [min or %B]) MS2 score: 33.46
21127740AVFPSIVGRPR599.86 (observed)22.62E+0624.44 (HPLC [min or %B]) MS2 score: 23.29
21127740AVFPSIVGRPR599.86 (observed)21.44E+0623.65 (HPLC [min or %B]) MS2 score: 26.24
21127740AVFPSIVGRPR599.86 (observed)29.54E+0519.87 (HPLC [min or %B]) MS2 score: 22.41
21127740AVFPSIVGRPR599.86 (observed)24.25E+0520.08 (HPLC [min or %B]) MS2 score: 28.79
21127740AVFPSIVGRPR599.85 (observed)22.01E+0623.2 (HPLC [min or %B]) MS2 score: 22.92
21127740AVFPSIVGRPR599.86 (observed)25.66E+0521.71 (HPLC [min or %B]) MS2 score: 56.65
21127740AVFPSIVGRPR599.86 (observed)22.50E+0621.55 (HPLC [min or %B]) MS2 score: 43.77
21127740CDVDIR389.18 (observed)22.14E+069.39 (HPLC [min or %B]) MS2 score: 26.06
21127740CDVDIR389.18 (observed)25.91E+0516.74 (HPLC [min or %B]) MS2 score: 26.79
21127740CDVDIR389.18 (observed)21.60E+0813.67 (HPLC [min or %B]) MS2 score: 34.7
21127740CDVDIRK453.23 (observed)25.46E+0610.32 (HPLC [min or %B]) MS2 score: 35.71
21127740DLTDYLMK507.74 (observed)22.33E+0630.4 (HPLC [min or %B])Oxidation (M)MS2 score: 39.58
21127740DLTDYLMK507.74 (observed)22.01E+0630.77 (HPLC [min or %B])Oxidation (M)MS2 score: 38.2
21127740DLTDYLMK499.75 (observed)21.99E+0625.42 (HPLC [min or %B]) MS2 score: 39.53
21127740DLTDYLMK499.75 (observed)21.75E+0530.27 (HPLC [min or %B]) MS2 score: 22.57
21127740DLYANTVLSGGTTMYPGIADR744.69 (observed)36.03E+0630.76 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 86.89
21127740DLYANTVLSGGTTMYPGIADR1116.53 (observed)23.96E+0630.78 (HPLC [min or %B])Deamidation (NQ); Oxidation (M)MS2 score: 68.67
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)27.35E+0530.89 (HPLC [min or %B])Oxidation (M)MS2 score: 86.43
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)22.43E+0530.3 (HPLC [min or %B])Oxidation (M)MS2 score: 52.02
21127740DLYANTVLSGGTTMYPGIADR1116.04 (observed)24.08E+0527.26 (HPLC [min or %B])Oxidation (M)MS2 score: 65.86
21127740DSYVGDEAQSK599.76 (observed)22.28E+0511.6 (HPLC [min or %B]) MS2 score: 37.82
21127740DSYVGDEAQSK599.76 (observed)21.68E+0511.72 (HPLC [min or %B]) MS2 score: 55.87
21127740DSYVGDEAQSK599.76 (observed)28.86E+048.41 (HPLC [min or %B]) MS2 score: 40.73
21127740DSYVGDEAQSK599.76 (observed)23.90E+0511.93 (HPLC [min or %B]) MS2 score: 55.72
21127740DSYVGDEAQSKR677.81 (observed)23.74E+0513.74 (HPLC [min or %B]) MS2 score: 45.27
21127740DSYVGDEAQSKR677.81 (observed)23.36E+0514.02 (HPLC [min or %B]) MS2 score: 57.43
21127740EITALAPSTMK589.31 (observed)21.45E+0514.25 (HPLC [min or %B])Oxidation (M)MS2 score: 30.32
21127740HQGVMVGMGQK602.28 (observed)21.04E+068.01 (HPLC [min or %B])2 Oxidation (M)MS2 score: 24.28
21127740HQGVMVGMGQK401.86 (observed)31.87E+068.04 (HPLC [min or %B])2 Oxidation (M)MS2 score: 34.62
21127740HQGVMVGMGQK586.29 (observed)22.61E+0517.29 (HPLC [min or %B]) MS2 score: 26.9
21127740IIAPPER398.24 (observed)26.84E+0414.7 (HPLC [min or %B]) MS2 score: 21.38
21127740IIAPPER398.24 (observed)28.42E+0410.87 (HPLC [min or %B]) MS2 score: 25.03
21127740IIAPPERK462.29 (observed)26.38E+0511.9 (HPLC [min or %B]) MS2 score: 23.88
21127740IWHHTFYNELR505.92 (observed)35.40E+0521.93 (HPLC [min or %B]) MS2 score: 28.62
21127740IWHHTFYNELR505.92 (observed)35.92E+0522.15 (HPLC [min or %B]) MS2 score: 34.36
21538913K.AGFAGDDAPR.A    MS2 score: 31 
21538913K.AGFAGDDAPR.A    MS2 score: 24 
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 11   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 50   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 15   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 36   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 33   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 48   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 9   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 7   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 31   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 40   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 45   
UNPUBLISHED_1K.AGFAGDDAPR.A    MS2 score: 17   
UNPUBLISHED_1K.DLYANTVLSGGTTMYPGIADR.M    MS2 score: 31   
21538913K.DSYVGDEAQSK.R    MS2 score: 36 
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 12   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 34   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 9   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 8   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 20   
UNPUBLISHED_1K.DSYVGDEAQSK.R    MS2 score: 7   
UNPUBLISHED_1K.DSYVGDEAQSKR.G    MS2 score: 30   
UNPUBLISHED_1K.DSYVGDEAQSKR.G    MS2 score: 20   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 15   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 10   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 24   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 24   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 19   
UNPUBLISHED_1K.EITALAPSTMK.I    MS2 score: 1   
UNPUBLISHED_1K.IIAPPER.K    MS2 score: 0   
UNPUBLISHED_1K.IIAPPERK.Y    MS2 score: 2   
UNPUBLISHED_1K.IKIIAPPER.K    MS2 score: 14   
UNPUBLISHED_1K.IKIIAPPER.K    MS2 score: 9   
21538913K.ILTER.G    MS2 score: 9 
21538913K.IWHHTFYNELR.V    MS2 score: 13 
UNPUBLISHED_1K.IWHHTFYNELR.V    MS2 score: 9   
UNPUBLISHED_1K.IWHHTFYNELR.V    MS2 score: 12   
21538913K.QEYDESGPSIVHR.K    MS2 score: 17 
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 2   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 1   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 9   
UNPUBLISHED_1K.QEYDESGPSIVHR.K    MS2 score: 14   
UNPUBLISHED_1K.QEYDESGPSIVHRK.C    MS2 score: 5   
UNPUBLISHED_1K.QEYDESGPSIVHRK.C    MS2 score: 1   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 5   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 7   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 11   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 19   
UNPUBLISHED_1K.RGILTLK.Y    MS2 score: 24   
21538913K.SYELPDGQVITIGNER.F    MS2 score: 60 
21538913K.SYELPDGQVITIGNER.F    MS2 score: 37 
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 15   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 41   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 48   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 18   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 29   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 20   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 21   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 48   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 36   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 45   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 40   
UNPUBLISHED_1K.SYELPDGQVITIGNER.F    MS2 score: 32   
UNPUBLISHED_1K.SYELPDGQVITIGNERFR.C    MS2 score: 9   
UNPUBLISHED_1K.YPIEHGIVTNWDDMEK.I    MS2 score: 0   
21538913M.DDDIAALVVDNGSGMCKAGFAGDDAPR.A    MS2 score: 0 
21127740QEYDESGPSIVHR506.24 (observed)31.75E+0512.97 (HPLC [min or %B]) MS2 score: 39.68
21127740QEYDESGPSIVHR750.34 (observed)24.51E+0516.44 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 26.38
21538913R.AVFPSIVGRPR.H    MS2 score: 12 
21538913R.AVFPSIVGRPR.H    MS2 score: 23 
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 22   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 16   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 32   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 28   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 27   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 11   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 24   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 3   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 6   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 33   
UNPUBLISHED_1R.AVFPSIVGRPR.H    MS2 score: 23   
21538913R.DIKEK.L    MS2 score: 15 
UNPUBLISHED_1R.DIKEK.L    MS2 score: 3   
21538913R.DLTDYLMK.I    MS2 score: 7 
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 9   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 10   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 12   
UNPUBLISHED_1R.DLTDYLMK.I    MS2 score: 10   
21538913R.GYSFTTTAER.E    MS2 score: 15 
21538913R.GYSFTTTAER.E    MS2 score: 24 
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 5   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 20   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 21   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 23   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 20   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 5   
UNPUBLISHED_1R.GYSFTTTAER.E    MS2 score: 15   
21538913R.GYSFTTTAEREIVR.D    MS2 score: 0 
UNPUBLISHED_1R.GYSFTTTAEREIVR.D    MS2 score: 15   
UNPUBLISHED_1R.GYSFTTTAEREIVR.D    MS2 score: 3   
UNPUBLISHED_1R.HQGVMVGMGQK.D    MS2 score: 3   
21538913R.LDLAGR.D    MS2 score: 18 
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 1   
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 10   
UNPUBLISHED_1R.LDLAGR.D    MS2 score: 23   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 7   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 4   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 14   
UNPUBLISHED_1R.LDLAGRDLTDYLMK.I    MS2 score: 8   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 3   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 1   
UNPUBLISHED_1R.MQKEITALAPSTMK.I    MS2 score: 20   
21538913R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L    MS2 score: 27 
21538913R.TTGIVMDSGDGVTHTVPIYEGYALPHAILR.L    MS2 score: 26 
21538913R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 17 
21538913R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 26 
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 21   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 15   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 6   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 38   
UNPUBLISHED_1R.VAPEEHPVLLTEAPLNPK.A    MS2 score: 7   
21127740RGILTLK400.77 (observed)22.58E+0619.87 (HPLC [min or %B]) MS2 score: 24.05
21127740RGILTLK400.77 (observed)21.35E+0614.43 (HPLC [min or %B]) MS2 score: 20.46
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)26.18E+0626.3 (HPLC [min or %B]) MS2 score: 57.07
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)31.44E+0626.23 (HPLC [min or %B]) MS2 score: 23.57
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)23.18E+0526.1 (HPLC [min or %B]) MS2 score: 34.24
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)21.06E+0625.69 (HPLC [min or %B]) MS2 score: 38.49
21127740VAPEEHPVLLTEAPLNPK652.36 (observed)32.07E+0725.4 (HPLC [min or %B])Deamidation (NQ)MS2 score: 41.03
21127740VAPEEHPVLLTEAPLNPK652.03 (observed)31.17E+0624.98 (HPLC [min or %B]) MS2 score: 30.55
21127740VAPEEHPVLLTEAPLNPK977.54 (observed)24.25E+0523.19 (HPLC [min or %B]) MS2 score: 41.22
23308193AGFAGDDAPR     MS2 score: 2433.0peptide count: 22
23308193DLTDYLMK     MS2 score: 2433.0peptide count: 22
23308193DLYANTVLSGGTTMYPGIADR     MS2 score: 2433.0peptide count: 22
23308193DSYVGDEAQSK     MS2 score: 2433.0peptide count: 22
23308193DSYVGDEAQSKR     MS2 score: 2433.0peptide count: 22
23308193EITALAPSTMK     MS2 score: 2433.0peptide count: 22
23308193EITALAPSTMKIK     MS2 score: 2433.0peptide count: 22
23308193GYSFTTTAER     MS2 score: 2433.0peptide count: 22
23308193HQGVMVGMGQK     MS2 score: 2433.0peptide count: 22
23308193IIAPPER     MS2 score: 2433.0peptide count: 22
23308193KDLYANTVLSGGTTMYPGIADR     MS2 score: 2433.0peptide count: 22
23308193LCYVALDFEQEMATAASSSSLEK     MS2 score: 2433.0peptide count: 22
23308193LDLAGRDLTDYLMK     MS2 score: 2433.0peptide count: 22
23308193MDDDIAALVVDNGSGMCK     MS2 score: 2433.0peptide count: 22
23308193SYELPDGQVITIGNER     MS2 score: 2433.0peptide count: 22
23308193VAPEEHPVLLTEAPLNPK     MS2 score: 2433.0peptide count: 22
23308193YPIEHGIVTNWDDMEK     MS2 score: 2433.0peptide count: 22

Compile date 12-23-2014© PADB initiative