PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A3877ADD3, ADDLGamma adducin

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18501002KSDVEIPATVTAFSFEDDSAPLSPLKF 2    
18501002KSFTSMDAPVMIMNGKDEMHDVEDELAQRV 3    
18501002KVSSGTPIKIEDPNQFVPLNTNPTEVLEKR 3    
18501002KVSSGTPIKIEDPNQFVPLNTNPTEVLEKRN 3    
18501002RHKSDVEIPATVTAFSFEDDSAPLSPLKF 3    
18501002RWLNSPNTYMKV 2    
18501002RYFDRINESDPEYLRE 3    
21616181IEDPNQFVPLNTNPTEVLEK2585.38034 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex)XCorr (Sequest): 3.23peptide count: 1
21616181IEDPNQFVPLNTNPTEVLEK2585.37236 (observed)   N-Term(iTRAQ4plex), K20(iTRAQ4plex)peptide count: 2
21616181INESDPEYLR1379.69451 (observed)   N-Term(iTRAQ4plex)XCorr (Sequest): 3.67peptide count: 1
21616181INESDPEYLR1379.69512 (observed)   N-Term(iTRAQ4plex)XCorr (Sequest): 3.54peptide count: 1
21616181SDVEIPATVTAFSFEDDSAPLSPLK2924.50467 (observed)   N-Term(iTRAQ4plex), K25(iTRAQ4plex)peptide count: 3
21616181VNIIGEVVDQGSTDLK1975.10039 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 8
21616181VNIIGEVVDQGSTDLK1975.10369 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 8

Compile date 12-23-2014© PADB initiative