PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A3876ADD1, ADDAAlpha adducin

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16507876K.TAGPQSQVLCGVMMDR.S1951.8 (expected)2    
15020595K.VNLQGDIVDR.G       
18501002KEYQPHVIVSTTGPNPFNTLTDRE 3    
18501002KSPPDQSAVPNTPPSTPVKL 2    
18501002KSPPDQSAVPNTPPSTPVKLEEDLPQEPTSRD 3    
18501002KSRSPGTPAGEGSGSPPKWQIGEQEFEALMRM 3    
15020595R.SLVQGELVTASK.A       
15020595R.TLASAGGPDNLVLLDPGK.Y       
18501002RAAVVTSPPPTTAPHKE 3    
18501002RSPGTPAGEGSGSPPKWQIGEQEFEALMRM 3    
18501002RTGYPYRYPALRE 2    
18501002RTSTSAVPNLFVPLNTNPKE 2    
18501002RYFDRVDENNPEYLRE 2    
18501002RYFDRVDENNPEYLRERN 3    
18614015(K)GSEENLDETR(E)      peptide count: 1
18614015(K)GSEENLDETR(E)      peptide count: 1
18614015(R)GSDSIAYDKGEK(L)      peptide count: 2
18614015(R)GSDSIAYDKGEK(L)      peptide count: 2
18614015(R)LADLFGWSQLIYNHITTR(V)      peptide count: 3
18614015(R)LADLFGWSQLIYNHITTR(V)      peptide count: 3
21616181TAGPQSQVLCGVMMDR1882.87847 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)MS2 score: 48peptide count: 1
21616181TAGPQSQVLCGVMMDR1882.8803 (observed)   N-Term(iTRAQ4plex), C10(Methylthio) peptide count: 1
21616181VNLQGDIVDR1272.70708 (observed)   N-Term(iTRAQ4plex)MS2 score: 39peptide count: 2
21616181WQIGEQEFEALMR1780.88835 (observed)   N-Term(iTRAQ4plex)peptide count: 2

Compile date 12-23-2014© PADB initiative