PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A3694ACAT1, ACAT, MATAcetyl-CoA acetyltransferase, mitochondrial precursor

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16507876K.IHMGNCAENTAK.K1531.6 (expected)2    
18501002KAGIPKEEVKEVYM*GNVIQGGEGQAPTRQ 3    
18501002KAGIPKEEVKEVYMGNVIQGGEGQAPTRQ 3    
18501002KDGLTDVYNKIHMGNCAENTAKK 3    
18501002KEAWDAGKFASEITPITISVKG 2    
18501002KEEVKEVYM*GNVIQGGEGQAPTRQ 3    
18501002KEEVKEVYMGNVIQGGEGQAPTRQ 2    
18501002KEEVKEVYMGNVIQGGEGQAPTRQ 3    
18501002KENGTITAANASTLNDGAAALVLM*TAEAAQRL 2    
18501002KENGTITAANASTLNDGAAALVLMTAEAAQRL 3    
18501002KENGTITAANASTLNDGAAALVLMTAEAAQRL 2    
18501002KEVYM*GNVIQGGEGQAPTRQ 2    
18501002KEVYMGNVIQGGEGQAPTRQ 2    
18501002KFASEITPITISVKG 2    
18501002KGKPDVVVKEDEEYKR 3    
18501002KGKPDVVVKEDEEYKRV 3    
18501002KLEDLIVKDGLTDVYNKI 2    
18501002KLEDLIVKDGLTDVYNKI 3    
18501002KLGTAAIQGAIEKA 2    
18501002KM*LEIDPQKVNIHGGAVSLGHPIGM*SGARI 3    
18501002KM*LEIDPQKVNIHGGAVSLGHPIGMSGARI 3    
18501002KMLEIDPQKVNIHGGAVSLGHPIGM*SGARI 2    
18501002KMLEIDPQKVNIHGGAVSLGHPIGM*SGARI 3    
18501002KMLEIDPQKVNIHGGAVSLGHPIGMSGARI 3    
18501002KMLEIDPQKVNIHGGAVSLGHPIGMSGARI 2    
18501002KTVFQKENGTITAANASTLNDGAAALVLM*TAEAAQRL 3    
18501002KTVFQKENGTITAANASTLNDGAAALVLMTAEAAQRL 3    
18501002KVNIHGGAVSLGHPIGMSGARI 3    
18501002KVNIHGGAVSLGHPIGMSGARI 2    
18501002RGATPYGGVKLEDLIVKD 2    
18501002RGATPYGGVKLEDLIVKDGLTDVYNKI 3    
18501002RIAAFADAAVDPIDFPLAPAYAVPKV 2    
18501002RIAAFADAAVDPIDFPLAPAYAVPKV 3    
18501002RQATLGAGLPISTPCTTVNKVCASGMKA 3    
18501002RQEQDTYALSSYTRS 2    
18501002RSKEAWDAGKFASEITPITISVKG 3    
18501002RSKEAWDAGKFASEITPITISVKG 2    
18501002RTPIGSFLGSLASQPATKL 3    
18501002RTPIGSFLGSLASQPATKL 2    
16684767KFGNEVIPVTVTVKG 2    
16684767KIHMGSCAENTAKK 2    
18614015(K)AGIPKEEVK(E)      peptide count: 39
18614015(K)DGLTDVYNK(I)      peptide count: 82
18614015(K)EAWDAGK(F)      peptide count: 13
18614015(K)EDEEYKR(V)      peptide count: 20
18614015(K)EDIAMWEVNEAFSVVVLANIK(M)      peptide count: 11
18614015(K)EEVKEVYMGNVIQGGEGQAPTR(Q)      peptide count: 25
18614015(K)ENGTITAANASTLNDGAAALVLMTAEAAQR(L)      peptide count: 3
18614015(K)ENGTITAANASTLNDGAAALVLMTAEAAQR(L)      peptide count: 41
18614015(K)EVYMGNVIQGGEGQAPTR(Q)      peptide count: 77
18614015(K)FASEITPITISVK(G)      peptide count: 33
18614015(K)GAMGRTR(L)      peptide count: 1
18614015(K)GKPDVVVK(E)      peptide count: 27
18614015(K)GKPDVVVKEDEEYK(R)      peptide count: 8
18614015(K)GKPDVVVKEDEEYKR(V)      peptide count: 144
18614015(K)IHMGNCAENTAK(K)      peptide count: 39
18614015(K)IHMGNCAENTAKK(M)      peptide count: 4
18614015(K)KEDIAMWEVNEAFSVVVLANIK(M)      peptide count: 3
18614015(K)KMNISR(Q)      peptide count: 6
18614015(K)KMNISR(Q)      peptide count: 3
18614015(K)LEDLIVK(D)      peptide count: 47
18614015(K)LEDLIVKDGLTDVYNK(I)      peptide count: 3
18614015(K)LGTAAIQGAIEK(A)      peptide count: 111
18614015(K)MLEIDPQK(V)      peptide count: 25
18614015(K)MLEIDPQKVNIHGGAVSLGHPIGMSGAR(I)      peptide count: 3
18614015(K)MNISR(Q)      peptide count: 3
18614015(K)RVDFSK(V)      peptide count: 2
18614015(K)TVFQK(E)      peptide count: 1
18614015(K)TVFQKENGTITAANASTLNDGAAALVLMTAEAAQR(L)      peptide count: 1
18614015(K)VCASGMK(A)      peptide count: 7
18614015(K)VNIHGGAVSLGHPIGMSGAR(I)      peptide count: 103
18614015(K)YAGLKK(E)      peptide count: 40
18614015(R)GATPYGGVK(L)      peptide count: 3
18614015(R)GATPYGGVKLEDLIVK(D)      peptide count: 6
18614015(R)GATPYGGVKLEDLIVKDGLTDVYNK(I)      peptide count: 3
18614015(R)IAAFADAAVDPIDFPLAPAYAVPK(V)      peptide count: 119
18614015(R)IVVHMAHALKPGEFGLASICNGGGGASALLIEK(L)      peptide count: 8
18614015(R)IVVHMAHALKPGEFGLASICNGGGGASALLIEKL(-)      peptide count: 13
18614015(R)LNVKPLAR(I)      peptide count: 105
18614015(R)QATLGAGLPISTPCTTVNK(V)      peptide count: 39
18614015(R)QEQDTYALSSYTR(S)      peptide count: 70
18614015(R)SKEAWDAGK(F)      peptide count: 85
18614015(R)TPIGSFLGSLASQPATK(L)      peptide count: 66
15253431DGLTDVYNK 2   Pept_E (Sonar search): 4.30E-03 
15253431EAYM*GNVLQGGEGQAPTR 2   Pept_E (Sonar search): 5.10E-01 
15253431EAYM*GNVLQGGEGQAPTR 3   Pept_E (Sonar search): 5.40E-03 
15253431EVVIVSATR 2   Pept_E (Sonar search): 7.50E-01 
15253431FGNEVIPVTVTVK 2   Pept_E (Sonar search): 1.20E-02 
15253431IVAFADAAVEPIDFPIAPVYAASMVLK 3   Pept_E (Sonar search): 1.20E-01 
15253431IVGHLTHALK 2   Pept_E (Sonar search): 1.50E-05 
15253431IVGHLTHALK 2    
15253431LEDLIVK 2   Pept_E (Sonar search): 4.00E-01 
15253431LGSIAIQGAIEK 2   Pept_E (Sonar search): 1.20E-03 
15253431LNVTPLAR 2   Pept_E (Sonar search): 8.40E-01 
15253431NEQDAYAINSYTR 2   Pept_E (Sonar search): 3.00E-03 
15253431QAVLGAGLPISTPCTTINK 3   Pept_E (Sonar search): 4.20E-03 
15253431QGEYGLASICNGGGGASAM*LIQK 3   Pept_E (Sonar search): 1.30E-02 
15253431TPIGSFLGSLSLLPATK 2   Pept_E (Sonar search): 2.60E-02 
15253431TPIGSFLGSLSLLPATK 3   Pept_E (Sonar search): 5.00E-02 
15253431VNINGGAVSLGHPIGMSGAR 3   Pept_E (Sonar search): 5.00E-02 
21127740TPIGSFLGSLSLLPATK568 (observed)32.67E+0544.6 (HPLC [min or %B]) MS2 score: 26.31
21127740DGLTDVYNK512.75 (observed)21.37E+0623.21 (HPLC [min or %B]) MS2 score: 34.17
21127740EVVIVSATR487.29 (observed)22.25E+0613.98 (HPLC [min or %B]) MS2 score: 28.76
21127740FGNEVIPVTVTVK701.9 (observed)29.96E+0525.34 (HPLC [min or %B]) MS2 score: 34.3
21127740FGNEVIPVTVTVK701.9 (observed)21.11E+0632.7 (HPLC [min or %B]) MS2 score: 49.42
21127740FGNEVIPVTVTVK701.9 (observed)25.57E+0629.02 (HPLC [min or %B]) MS2 score: 43.68
21127740LNVTPLAR442.27 (observed)21.75E+0621.14 (HPLC [min or %B]) MS2 score: 33.47
21127740LNVTPLAR442.27 (observed)21.25E+0624.64 (HPLC [min or %B]) MS2 score: 21.09
21127740NEQDAYAINSYTR772.86 (observed)28.39E+0521.16 (HPLC [min or %B]) MS2 score: 86.21
21127740TPIGSFLGSLSLLPATK851.49 (observed)23.70E+0541.51 (HPLC [min or %B]) MS2 score: 33.6
21127740TPIGSFLGSLSLLPATK851.49 (observed)21.17E+0644.49 (HPLC [min or %B]) MS2 score: 40.04
21127740TPIGSFLGSLSLLPATK851.49 (observed)25.94E+0548.36 (HPLC [min or %B]) MS2 score: 36.52
21127740TPIGSFLGSLSLLPATK851.49 (observed)24.56E+0543.92 (HPLC [min or %B]) MS2 score: 55.89
21127740TPIGSFLGSLSLLPATK851.49 (observed)23.09E+0541.53 (HPLC [min or %B]) MS2 score: 26.38
21127740TPIGSFLGSLSLLPATK851.49 (observed)24.44E+0540.84 (HPLC [min or %B]) MS2 score: 24.69
18563753DGLTDVYNJ2    
18563753DGLTDVYNJ2    
18563753DGLTDVYNJ2    
23376485DGLTDVYNK512.752 (observed)   ::::::::::
23376485EAYMGNVLQGGEGQAPTR947.449 (observed)   ::::Oxidation_M:::::::::::::::
18563753EEQDJYAIGSYTR3    
18563753EEQDJYAIGSYTR3    
18563753EEQDJYAIGSYTR3    
18563753EEQDJYAIGSYTR3    
18563753EEQDJYAIGSYTR3    
18563753EEQDJYAIGSYTR3    
18563753EVYMGNVIQGGEGQAPTR3    
18563753EVYMGNVIQGGEGQAPTR3    
18563753EVYMGNVIQGGEGQAPTR3    
18563753FANEITPITISVJ3    
18563753FANEITPITISVJ3    
18563753FANEITPITISVJ2    
18563753FANEITPITISVJ2    
18563753FANEITPITISVJ2    
18563753FANEITPITISVJ2    
18563753FANEITPITISVJ3    
18563753FANEITPITISVJ2    
23376485FGNEVIPVTVTVK701.901 (observed)   ::::::::::::::
18563753GATPUGGVKLEDLIVJ3    
18563753IAAFADAAVDPIDFPLAPAYAVPJ3    
18563753IAAFADAAVDPIDFPLAPAYAVPJ3    
18563753IAAFADAAVDPIDFPLAPAYAVPJ4    
18563753IAAFADAAVDPIDFPLAPAYAVPJ3    
18563753IAAFADAAVDPIDFPLAPAYAVPJ3    
18563753IAAFADAAVDPIDFPLAPAYAVPJ3    
18563753IHMGNCAENTAJ3    
18563753LEDLIVJ2    
18563753LEDLIVJ2    
18563753LEDLIVJ2    
18563753LEDLIVJ2    
18563753LEDLIVJ2    
18563753LEDLIVJ2    
18563753LEDLIVJDGLTDVYNJ3    
18563753LEDLIVJDGLTDVYNJ4    
18563753LEDLIVJDGLTDVYNJ4    
23376485LGSIAIQGAIEK600.355 (observed)   :::::::::::::
23376485LGSIAIQGAIEK600.355 (observed)   :::::::::::::
18563753LGTIAIQGAIEJ3    
18563753LGTIAIQGAIEJ3    
23376485LNVTPLAR442.272 (observed)   :::::::::
23376485NEQDAYAINSYTR772.856 (observed)   ::::::::::::::
23376485NEQDAYAINSYTR772.853 (observed)   ::::::::::::::
23376485NEQDAYAINSYTR772.856 (observed)   ::::::::::::::
18563753QATLGAGLPIATPCTTVNJ3    
18563753QATLGAGLPIATPCTTVNJ3    
18563753QATLGAGLPIATPCTTVNJ3    
18563753QATLGAGLPIATPCTTVNJ3    
18563753TPIGSFLGSLASQPATJ3    
18563753TPIGSFLGSLASQPATJ3    
18563753TPIGSFLGSLASQPATJ2    
18563753TPIGSFLGSLASQPATJ3    
18563753TPIGSFLGSLASQPATJ2    
18563753TPIGSFLGSLASQPATJ3    
18563753TPIGSFLGSLASQPATJ3    

Compile date 12-23-2014© PADB initiative