PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A3582ACACA, ACAC, ACC1Acetyl-CoA carboxylase 1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
18614015(K)ANAEYIK(M)      peptide count: 1
18614015(K)ATLVEHGIR(R)      peptide count: 1
18614015(K)AYVWDNNKDLVEWLEK(Q)      peptide count: 2
18614015(K)DLLQSK(R)      peptide count: 3
18614015(K)DPIDR(I)      peptide count: 1
18614015(K)EASFEYLQNEGER(L)      peptide count: 1
18614015(K)GVINDILDWK(T)      peptide count: 1
18614015(K)GVINDILDWKTSR(T)      peptide count: 1
18614015(K)IASSIVAQTAGIPTLPWSGSGLR(V)      peptide count: 1
18614015(K)IIQQAGQVWFPDSAFK(T)      peptide count: 2
18614015(K)ITDIIGKEEGLGAENLR(G)      peptide count: 1
18614015(K)LILSETSIFDVLPNFFYHSNQVVR(M)      peptide count: 1
18614015(K)LPELLLK(N)      peptide count: 1
18614015(K)NLLVTMLIDQLCGR(D)      peptide count: 1
18614015(K)QLTEEDGVR(S)      peptide count: 1
18614015(K)QQEYLK(L)      peptide count: 2
18614015(K)SPEYPDGR(D)      peptide count: 1
18614015(K)TLELNQHSR(F)      peptide count: 1
18614015(K)VQQAELHTGSLPQIQSTALRGEK(L)      peptide count: 1
18614015(K)YISRDYVLK(Q)      peptide count: 2
18614015(R)AIGIGAYLVR(L)      peptide count: 1
18614015(R)DCSVQR(R)      peptide count: 2
18614015(R)DKFEEDR(I)      peptide count: 1
18614015(R)DPTLTDELLNILTELTQLSK(T)      peptide count: 3
18614015(R)EGLPLMVFANWR(G)      peptide count: 1
18614015(R)ELESK(F)      peptide count: 1
18614015(R)GHVIAAR(I)      peptide count: 1
18614015(R)IGLAEEIR(H)      peptide count: 1
18614015(R)IGSFGPQEDLLFLR(A)      peptide count: 2
18614015(R)ITSENPDEGFKPSSGTVQELNFR(S)      peptide count: 1
18614015(R)KKDLVK(L)      peptide count: 1
18614015(R)LGGIPVGVVAVETR(T)      peptide count: 1
18614015(R)LGTPELSPTER(K)      peptide count: 1
18614015(R)LLLEDLVK(K)      peptide count: 1
18614015(R)LLLEDLVKKK(I)      peptide count: 3
18614015(R)LMKTLRDPSLPLLELQDIMTSVPGRIPLNVEK(S)      peptide count: 1
18614015(R)TAQIMFQAYGDK(Q)      peptide count: 1
18614015(R)TFEDFVR(I)      peptide count: 1
21616181DFTVASPAEFVTR1583.82402 (observed)   N-Term(iTRAQ4plex)peptide count: 3
UNPUBLISHED_1K.DLLQSK.R    MS2 score: 38   
UNPUBLISHED_1K.ENDPSVMRSPSAGK.L    MS2 score: 5   
UNPUBLISHED_1R.EEAISNMVVALK.E    MS2 score: 0   
UNPUBLISHED_1R.TVELSIPADPANLDSEAK.I    MS2 score: 0   
23376485MWWSTLMSILRAR556.289 (observed)   :Oxidation_M:::::::::::::
23376485MWWSTLMSILRAR556.29 (observed)   :Oxidation_M:::::::::::::
23376485MWWSTLMSILRAR556.289 (observed)   :Oxidation_M:::::::::::::
23376485MWWSTLMSILRAR556.289 (observed)   :::::::Oxidation_M:::::::
23376485MWWSTLMSILRAR556.293 (observed)   :Oxidation_M:::::::::::::
23376485MWWSTLMSILRAR556.29 (observed)   :::::::Oxidation_M:::::::

Compile date 12-23-2014© PADB initiative