PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A2344ACTN4Alpha-actinin 4

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16901338ACLISLGYDVENDR2   MS2 score: 67 
16901338AGTQIENIDEDFRDGLK0.44 (delta mass [ppm])3   MS2 score: 32 
16901338AGTQIENIDEDFRDGLK3   MS2 score: 39 
16901338AIMTYVSSFYHAFSGAQK-0.81 (delta mass [ppm])3   MS2 score: 43 
16948836ALDFIASK1.7 (delta mass [ppm])2    
16709260ASIHEAWTDGK-0.422718801 (delta mass [ppm])2   MS2 score: 33 
16901338CQLEINFNTLQTK2   MS2 score: 72 
16901338DGLAFNALIHR0.36 (delta mass [ppm])2   MS2 score: 41 
16901338DGLAFNALIHR2   MS2 score: 41 
16709260DGLAFNALIHR0.416103468 (delta mass [ppm])2   MS2 score: 48 
16948836DGLAFNALIHR2.2 (delta mass [ppm])2    
16948836DLLLDPAWEK0.2 (delta mass [ppm])2    
16901338DYETATLSDIK2   MS2 score: 62 
16901338EAILAIHK2   MS2 score: 34 
16709260EAILAIHK1.693613242 (delta mass [ppm])2   MS2 score: 47 
16901338EGLLLWCQR2   MS2 score: 43 
16948836EGLLLWCQR0.8 (delta mass [ppm])2    
16901338ELPPDQAEYCIAR2   MS2 score: 52 
16709260ETTDTDTADQVIASFK0.211396408 (delta mass [ppm])2   MS2 score: 90 
16948836ETTDTDTADQVIASFK2 (delta mass [ppm])2    
16901338FAIQDISVEETSAK2   MS2 score: 91 
16709260FAIQDISVEETSAK1.168036465 (delta mass [ppm])2   MS2 score: 63 
16948836FAIQDISVEETSAK2.3 (delta mass [ppm])2    
16901338GISQEQMQEFR2   MS2 score: 26 
16709260GISQEQMQEFR-0.81605837 (delta mass [ppm])2   MS2 score: 44 
16901338GYEEWLLNEIR2   MS2 score: 67 
16948836GYEEWLLNEIR0.1 (delta mass [ppm])2    
16709260HRDYETATLSDIK0.533029083 (delta mass [ppm])3   MS2 score: 36 
16901338ICDQWDALGSLTHSR3   MS2 score: 44 
16948836ICDQWDALGSLTHSR0.3 (delta mass [ppm])3    
16901338ISIEMNGTLEDQLSHLK2.19 (delta mass [ppm])3  1Met(ox)MS2 score: 35 
16901338ISIEMNGTLEDQLSHLK3  1Met(ox)MS2 score: 40 
18501002KASIHEAWTDGKEAMLKQ 3    
18501002KASIHEAWTDGKEAMLKQ 2    
16901338KDDPVTNLNNAFEVAEK-0.70 (delta mass [ppm])3   MS2 score: 34 
16901338KDDPVTNLNNAFEVAEK3   MS2 score: 39 
18501002KGISQEQM*QEFRA 2    
18501002KLSGSNPYTTVTPQIINSKW 2    
18501002KQRDYETATLSDIKA 2    
18501002KVLAGDKNFITAEELRR 2    
18501002KVLAGDKNFITAEELRR 3    
16901338LASDLLEWIR2   MS2 score: 62 
16948836LASDLLEWIR0.6 (delta mass [ppm])2    
16901338LMLLLEVISGER2  1Met(ox)MS2 score: 86 
16709260LMLLLEVISGER0.605285688 (delta mass [ppm])2   MS2 score: 66 
16948836LMLLLEVISGER0.4 (delta mass [ppm])2    
16901338LSGSNPYTTVTPQIINSK2   MS2 score: 85 
16901338LSGSNPYTTVTPQIINSKWEK-0.96 (delta mass [ppm])3   MS2 score: 46 
16901338LVSIGAEEIVDGNAK-1.45 (delta mass [ppm])2   MS2 score: 69 
16901338LVSIGAEEIVDGNAK2   MS2 score: 97 
16901338MAPYQGPDAVPGALDYK2  1Met(ox)MS2 score: 55 
16901338MLDAEDIVNTARPDEK1.58 (delta mass [ppm])3  1Met(ox)MS2 score: 23 
16901338MLDAEDIVNTARPDEK2  1Met(ox)MS2 score: 45 
16901338MTLGMIWTIILR0.02 (delta mass [ppm])2  2Met(ox)MS2 score: 73 
16901338NFITAEELR2   MS2 score: 35 
16948836NFITAEELR1.4 (delta mass [ppm])2    
16709260NVNVQNFHISWK0.016164312 (delta mass [ppm])2   MS2 score: 68 
16901338QFASQANVVGPWIQTK0.88 (delta mass [ppm])2   MS2 score: 73 
16901338QFASQANVVGPWIQTK2   MS2 score: 50 
16709260QFASQANVVGPWIQTK-0.993840166 (delta mass [ppm])2   MS2 score: 40 
16901338QLEAIDQLHLEYAK2   MS2 score: 80 
16901338QLEAIDQLHLEYAKR0.89 (delta mass [ppm])3   MS2 score: 26 
15020595R.FAIQDISVEETSAK.E       
15020595R.M#APYQGPDAAPGALDYK.S       
15020595R.SIVDYKPNLDLLEQQHQLIQEALIFDNK.H       
15020595R.TINEVENQILTR.D       
15020595R.VGWEQLLTTIAR.T       
18501002RCQKICDQWDNLGSLTHSRR 3    
18501002RDYETATLSDIKA 2    
18501002RETTDTDTADQVIASFKV 2    
18501002RHRPELIEYDKLRK 3    
18501002RKDDPVTNLNNAFEVAEKY 3    
18501002RKDDPVTNLNNAFEVAEKY 2    
18501002RM*APYQGPDAAPGALDYKS 2    
18501002RMAPYQGPDAAPGALDYKS 2    
16901338RQFASQANVVGPWIQTK-1.52 (delta mass [ppm])3   MS2 score: 46 
18501002RRQFASQANMVGPWIQTKM 3    
18501002RVEQIAAIAQELNELDYYDSHNVNTRC 3    
16901338SFSTALYGESDL2   MS2 score: 54 
16948836SIVDYKPNLDLLEQQHQLIQEALIFDNK2.8 (delta mass [ppm])3    
16901338TINEVENQILTR-2.04 (delta mass [ppm])2   MS2 score: 65 
16901338TINEVENQILTR2   MS2 score: 62 
16901338TIPWLEDRVPQK1.81 (delta mass [ppm])2   MS2 score: 18 
16948836VEQIAAIAQELNELDYYDSHNVNTR0.8 (delta mass [ppm])3    
16948836VEQIAAIAQELNELDYYDSHNVNTR2.5 (delta mass [ppm])3    
16901338VGWEQLLTTIAR2.02 (delta mass [ppm])2   MS2 score: 74 
16901338VGWEQLLTTIAR2   MS2 score: 72 
16948836VGWEQLLTTIAR0.1 (delta mass [ppm])2    
16901338VLAGDKNFITAEELR3   MS2 score: 28 
16901338VLAGDKNFITAEELRR0.77 (delta mass [ppm])3   MS2 score: 43 
16901338VQQLVPK2   MS2 score: 37 
16684767KACLISLGYDVENDRQGEAEFNRI 3    
16684767KAIMTYVSSFYHAFSGAQKA 2    
16684767KALDFIASKG 2    
16684767KASIHEAWTDGKE 2    
16684767KASIHEAWTDGKEAMLKH 2    
16684767KCQLEINFNTLQTKL 2    
16684767KDDPVTNLNNAFEVAEKY 2    
16684767KEGLLLWCQRK 2    
16684767KEGLLLWCQRKT 2    
16684767KGYEEWLLNEIRR 2    
16684767KHRDYETATLSDIKA 2    
16684767KHTNYTM*EHIRV 2    
16684767KHTNYTMEHIRV 2    
16684767KICDQWDALGSLTHSRR 2    
16684767KLASDLLEWIRR 1    
16684767KLSGSNPYTTVTPQIINSKW 2    
16684767KTFTAWCNSHLRK 2    
16684767KVLAVNQENEHLM*EDYEKL 2    
16684767RELPPDQAEYCIARM 2    
16684767RETTDTDTADQVIASFKV 2    
16684767RFAIQDISVEETSAKE 2    
16684767RLDHLAEKF 1    
16684767RSIVDYKPNLDLLEQQHQLIQEALIFDNKH 3    
16684767RTINEVENQILTRD 2    
16684767RVGWEQLLTTIART 2    
18361515K.ASIHEAWTDGK.E607.97 (observed)2    
18361515K.ASIHEAWTDGK.E607.54 (observed)2    
18361515K.GYEEWLLNEIR.R711.55 (observed)2    
18361515K.KHEAFESDLAAHQDR.V877.17 (observed)2    
18361515K.LASDLLEWIR.R608.34 (observed)2    
18361515K.LSGSNPYTTVTPQIINSK.W960.36 (observed)2    
18361515K.LSGSNPYTTVTPQIINSK.W961.58 (observed)2    
18361515K.LVSIGAEEIVDGNAK.M758.27 (observed)2    
18361515K.NFITAEELR.R546.85 (observed)2    
18361515K.RDHALLEEQSK.Q663.23 (observed)2    
18361515K.TFTAWCNSHLR.K697.3 (observed)2    
18361515K.VLAGDKNFITAEELR.R837.73 (observed)2    
18361515R.ASFNHFDKDHGGALGPEEFK.A734.68 (observed)3    
18361515R.ASFNHFDKDHGGALGPEEFK.A735.08 (observed)3    
18361515R.ETTDTDTADQVIASFK.V871.47 (observed)2    
18361515R.ETTDTDTADQVIASFK.V871.82 (observed)2    
18361515R.HRPELIEYDK.L650.31 (observed)2    
18361515R.KDDPVTNLNNAFEVAEK.Y952.9 (observed)2    
18361515R.SIVDYKPNLDLLEQQHQLIQEALIFDNK.H1108.63 (observed)3    
18361515R.TINEVENQILTR.D715.33 (observed)2    
18361515R.VEQIAAIAQELNELDYYDSHNVNTR.C969.18 (observed)3    
18361515R.VGWEQLLTTIAR.T693.39 (observed)2    
18361515R.VGWEQLLTTIAR.T693.72 (observed)2    
18614015(-)MEELGR(V)      peptide count: 1
18614015(K)AIMTYVSSFYHAFSGAQK(A)      peptide count: 2
18614015(K)ALDFIASK(G)      peptide count: 1
18614015(K)ASIHEAWTDGK(E)      peptide count: 1
18614015(K)CQLEINFNTLQTK(L)      peptide count: 1
18614015(K)EGLLLWCQR(K)      peptide count: 3
18614015(K)EGLLLWCQRK(T)      peptide count: 1
18614015(K)GISQEQMQEFR(A)      peptide count: 3
18614015(K)GYEEWLLNEIR(R)      peptide count: 9
18614015(K)INNVNK(A)      peptide count: 1
18614015(K)LMLLLEVISGER(L)      peptide count: 6
18614015(K)QQSNEHLR(R)      peptide count: 1
18614015(K)RDHALLEEQSK(Q)      peptide count: 13
18614015(K)STLPDADR(E)      peptide count: 1
18614015(K)STLPDADRER(E)      peptide count: 7
18614015(K)TFTAWCNSHLR(K)      peptide count: 1
18614015(K)TIQEMQQK(L)      peptide count: 8
18614015(K)VQQLVPK(R)      peptide count: 3
18614015(K)YLDIPK(M)      peptide count: 3
18614015(R)CQKICDQWDNLGSLTHSRR(E)      peptide count: 5
18614015(R)DGLAFNALIHR(H)      peptide count: 1
18614015(R)DLLLDPAWEK(Q)      peptide count: 1
18614015(R)DYETATLSDIK(A)      peptide count: 3
18614015(R)ETTDTDTADQVIASFK(V)      peptide count: 2
18614015(R)FAIQDISVEETSAK(E)      peptide count: 4
18614015(R)HRPELIEYDKLR(K)      peptide count: 1
18614015(R)IAESNHIK(L)      peptide count: 10
18614015(R)IAESNHIKLSGSNPYTTVTPQIINSK(W)      peptide count: 2
18614015(R)KHEAFESDLAAHQDR(V)      peptide count: 3
18614015(R)LASDLLEWIR(R)      peptide count: 20
18614015(R)LDHLAEK(F)      peptide count: 25
18614015(R)LPKPER(G)      peptide count: 2
18614015(R)LSNRPAFMPSEGR(M)      peptide count: 1
18614015(R)MAPYQGPDAAPGALDYK(S)      peptide count: 1
18614015(R)QGDAEFNR(I)      peptide count: 1
18614015(R)SIVDYKPSLDLLEQQHQLIQEALIFDNK(H)      peptide count: 1
18614015(R)TINEVENQILTR(D)      peptide count: 5
18614015(R)VEQIAAIAQELNELDYYDSHNVNTR(C)      peptide count: 1
18614015(R)VGWEQLLTTIAR(T)      peptide count: 18
21616181ACLISLGYDVENDR1757.83501 (observed)   N-Term(iTRAQ4plex), C2(Methylthio)peptide count: 36
21616181ACLISLGYDVENDR1757.83452 (observed)   N-Term(iTRAQ4plex), C2(Methylthio)peptide count: 25
18578523ACLISLGYDVENDR2   
18578523ACLISLGYDVENDR2   
18578523ACLISLGYDVENDR2   
18578523ACLISLGYDVENDR2   
21616181AGTQIENIDEDFR1651.80742 (observed)   N-Term(iTRAQ4plex)peptide count: 23
21616181AGTQIENIDEDFR1651.80303 (observed)   N-Term(iTRAQ4plex)peptide count: 22
18578523AGTQIENIDEDFRDGLK2   
18578523AGTQIENIDEDFRDGLK2   
18578523AGTQIENIDEDFRDGLK3   
18578523AGTQIENIDEDFRDGLK2   
18578523AGTQIENIDEDFRDGLK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK3   
21616181ALDFIASK1152.67937 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 3
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK2   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASFNHFDKDHGGALGPEEFK3   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
21616181CQLEINFNTLQTK1885.9782 (observed)   N-Term(iTRAQ4plex), C1(Methylthio), K13(iTRAQ4plex)peptide count: 7
21616181CQLEINFNTLQTK1885.97513 (observed)   N-Term(iTRAQ4plex), C1(Methylthio), K13(iTRAQ4plex)peptide count: 4
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
21616181DDPVTNLNNAFEVAEK2064.05644 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 17
21616181DDPVTNLNNAFEVAEK2064.05229 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 17
18578523DGLAFNALIHR2   
21616181DLLLDPAWEK1487.84197 (observed)   N-Term(iTRAQ4plex), K10(iTRAQ4plex)peptide count: 6
21616181DLLLDPAWEK1487.83684 (observed)   N-Term(iTRAQ4plex), K10(iTRAQ4plex) peptide count: 2
21616181DYETATLSDIK1543.81145 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 27
21616181DYETATLSDIK1543.81352 (observed)   N-Term(iTRAQ4plex), K11(iTRAQ4plex)peptide count: 20
21616181EGLLLWCQR1307.67766 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 20
21616181EGLLLWCQR1307.67497 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 18
21616181ELPPDQAEYCIAR1694.80254 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 85
21616181ELPPDQAEYCIAR1694.8012 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 94
21616181ETTDTDTADQVIASFK2030.01726 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 48
21616181ETTDTDTADQVIASFK2030.01848 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 41
21616181FAIQDISVEETSAK1825.98625 (observed)   N-Term(iTRAQ4plex), K14(iTRAQ4plex)peptide count: 17
21616181FAIQDISVEETSAK1825.9876 (observed)   N-Term(iTRAQ4plex), K14(iTRAQ4plex)peptide count: 14
21616181GISQEQMQEFR1496.72954 (observed)   N-Term(iTRAQ4plex)peptide count: 47
21616181GISQEQMQEFR1512.72539 (observed)   N-Term(iTRAQ4plex), M7(Oxidation)peptide count: 11
21616181GISQEQMQEFR1496.72905 (observed)   N-Term(iTRAQ4plex)peptide count: 45
21616181GISQEQMQEFR1512.7282 (observed)   N-Term(iTRAQ4plex), M7(Oxidation)peptide count: 5
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
18578523GISQEQMQEFR2   
21616181GYEEWLLNEIR1565.81194 (observed)   N-Term(iTRAQ4plex)peptide count: 14
21616181GYEEWLLNEIR1565.81438 (observed)   N-Term(iTRAQ4plex)peptide count: 23
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523HEAFESDLAAHQDR2   
18578523HEAFESDLAAHQDR2   
18578523HEAFESDLAAHQDR2   
18578523HEAFESDLAAHQDR2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRDYETATLSDIK2   
18578523HRPELIEYDK2   
18578523HRPELIEYDK2   
18578523HRPELIEYDK2   
18578523HRPELIEYDK2   
18578523HRPELIEYDK2   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR3   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR3   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR3   
18578523HRPELIEYDKLR2   
18578523HRPELIEYDKLR3   
18578523HRPELIEYDKLR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523ICDQWDALGSLTHSR2   
18578523ICDQWDALGSLTHSR2   
18578523ICDQWDALGSLTHSR3   
18578523ICDQWDALGSLTHSR2   
18578523ICDQWDALGSLTHSR2   
18578523ICDQWDALGSLTHSR2   
18578523ICDQWDALGSLTHSR2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KDDPVTNLNNAFEVAEK2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KTFTAWCNSHLR2   
18578523KTFTAWCNSHLR3   
18578523KTFTAWCNSHLR2   
18578523KTFTAWCNSHLR2   
18578523KTFTAWCNSHLR3   
18578523LASDLLEWIR2   
18578523LASDLLEWIR2   
21616181LMLLLEVISGER1532.88713 (observed)   N-Term(iTRAQ4plex), M2(Oxidation)peptide count: 2
18578523LMLLLEVISGER2   
18578523LMLLLEVISGER2   
21616181LSGSNPYTTVTPQIINSK2208.22124 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 20
21616181LSGSNPYTTVTPQIINSK2208.2219 (observed)   N-Term(iTRAQ4plex), K18(iTRAQ4plex)peptide count: 23
21616181LVSIGAEEIVDGNAK1803.01579 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 27
21616181LVSIGAEEIVDGNAK1803.01787 (observed)   N-Term(iTRAQ4plex), K15(iTRAQ4plex)peptide count: 21
21616181MAPYQGPDAAPGALDYK2053.03325 (observed)   N-Term(iTRAQ4plex), K17(iTRAQ4plex)peptide count: 38
21616181MAPYQGPDAAPGALDYK2069.02915 (observed)   N-Term(iTRAQ4plex), M1(Oxidation), K17(iTRAQ4plex)peptide count: 14
21616181MAPYQGPDAAPGALDYK2053.03032 (observed)   N-Term(iTRAQ4plex), K17(iTRAQ4plex)peptide count: 27
21616181MAPYQGPDAAPGALDYK2069.02861 (observed)   N-Term(iTRAQ4plex), M1(Oxidation), K17(iTRAQ4plex)peptide count: 8
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MLDAEDIVNTARPDEK2   
18578523MVSDINNGWQHLEQAEK2   
21616181NFITAEELR1236.67412 (observed)   N-Term(iTRAQ4plex)peptide count: 28
21616181NFITAEELR1236.67168 (observed)   N-Term(iTRAQ4plex)peptide count: 16
18578523NVNVQNFHISWK2   
18578523NVNVQNFHISWK2   
21616181QFASQANMVGPWIQTK2094.10625 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 2
21616181QFASQANMVGPWIQTK2110.10263 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), K16(iTRAQ4plex)peptide count: 4
21616181QFASQANMVGPWIQTK2094.10454 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 2
21616181QFASQANMVGPWIQTK2110.09916 (observed)   N-Term(iTRAQ4plex), M8(Oxidation), K16(iTRAQ4plex)peptide count: 2
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523QLEAIDQLHLEYAK2   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523SIVDYKPNLDLLEQQHQLIQEALIFDNK3   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
21616181TINEVENQILTR1573.86943 (observed)   N-Term(iTRAQ4plex)peptide count: 50
21616181TINEVENQILTR1573.86809 (observed)   N-Term(iTRAQ4plex)peptide count: 65
18578523TINEVENQILTR2   
18578523TINEVENQILTR2   
18578523TIPWLEDRVPQK2   
18578523TIPWLEDRVPQK2   
21616181VEQIAAIAQELNELDYYDSHNVNTR3049.50638 (observed)   N-Term(iTRAQ4plex)peptide count: 11
21616181VEQIAAIAQELNELDYYDSHNVNTR3049.50893 (observed)   N-Term(iTRAQ4plex)MS2 score: 61peptide count: 2
18578523VEQIAAIAQELNELDYYDSHNVNTR3   
18578523VEQIAAIAQELNELDYYDSHNVNTR3   
18578523VEQIAAIAQELNELDYYDSHNVNTR3   
18578523VEQIAAIAQELNELDYYDSHNVNTR3   
21616181VGWEQLLTTIAR1530.88249 (observed)   N-Term(iTRAQ4plex)peptide count: 38
21616181VGWEQLLTTIAR1530.88042 (observed)   N-Term(iTRAQ4plex)peptide count: 31
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VLAGDKNFITAEELR2   
18578523VLAVNQENEHLMEDYEK2   
21127740DGLAFNALIHR409.56 (observed)31.50E+0625.17 (HPLC [min or %B]) MS2 score: 38.11
21127740DGLAFNALIHR409.56 (observed)39.94E+0525.32 (HPLC [min or %B]) MS2 score: 30.84
21127740DGLAFNALIHR613.84 (observed)21.50E+0625.39 (HPLC [min or %B]) MS2 score: 32.75
21127740GYEEWLLNEIR711.36 (observed)23.45E+0633.74 (HPLC [min or %B]) MS2 score: 51.41
21127740GYEEWLLNEIR711.36 (observed)23.48E+0633.77 (HPLC [min or %B]) MS2 score: 52.67
21127740GYEEWLLNEIR711.36 (observed)21.07E+0633.7 (HPLC [min or %B]) MS2 score: 30.48
21127740LASDLLEWIR608.34 (observed)21.86E+0539.01 (HPLC [min or %B]) MS2 score: 34.3
21127740LASDLLEWIR608.34 (observed)27.15E+0644.8 (HPLC [min or %B]) MS2 score: 76
21127740LASDLLEWIR608.34 (observed)28.54E+0544.35 (HPLC [min or %B]) MS2 score: 28.17
21127740LASDLLEWIR608.34 (observed)21.03E+0543.98 (HPLC [min or %B]) MS2 score: 57.2
21127740LASDLLEWIR608.34 (observed)21.03E+0636.38 (HPLC [min or %B]) MS2 score: 38.14
21127740LASDLLEWIR608.34 (observed)24.20E+0638.82 (HPLC [min or %B]) MS2 score: 80.52
21127740LASDLLEWIR608.34 (observed)21.97E+0639.1 (HPLC [min or %B]) MS2 score: 52.18
21127740LASDLLEWIR608.34 (observed)25.65E+0538.99 (HPLC [min or %B]) MS2 score: 27.86
21127740LASDLLEWIR608.34 (observed)22.68E+0544.57 (HPLC [min or %B]) MS2 score: 35.3
21127740LASDLLEWIR608.34 (observed)23.97E+0539.06 (HPLC [min or %B]) MS2 score: 74.08
21127740LASDLLEWIR608.34 (observed)22.59E+0535.05 (HPLC [min or %B]) MS2 score: 60.67
21127740LASDLLEWIR608.34 (observed)28.09E+0435.29 (HPLC [min or %B]) MS2 score: 59.16
21127740LASDLLEWIR608.34 (observed)22.08E+0535.36 (HPLC [min or %B]) MS2 score: 54.03
21127740LASDLLEWIR608.34 (observed)23.01E+0635.07 (HPLC [min or %B]) MS2 score: 52.14
21127740LASDLLEWIR608.34 (observed)27.34E+0545.09 (HPLC [min or %B]) MS2 score: 42.03
21127740LASDLLEWIR608.34 (observed)21.01E+0644.37 (HPLC [min or %B]) MS2 score: 72.5
21127740LASDLLEWIR608.34 (observed)21.05E+0645.57 (HPLC [min or %B]) MS2 score: 75.45
21127740LASDLLEWIR608.34 (observed)25.57E+0535.72 (HPLC [min or %B]) MS2 score: 50.24
21127740LASDLLEWIR608.34 (observed)21.86E+0535.46 (HPLC [min or %B]) MS2 score: 49.15
21127740LMLLLEVISGER686.9 (observed)29.60E+0444.73 (HPLC [min or %B]) MS2 score: 26.43
21127740LMLLLEVISGER686.9 (observed)21.63E+0544.89 (HPLC [min or %B]) MS2 score: 39.94
21127740LMLLLEVISGER686.9 (observed)21.16E+0545.07 (HPLC [min or %B]) MS2 score: 36.25
21127740VGWEQLLTTIAR693.89 (observed)21.10E+0542.51 (HPLC [min or %B]) MS2 score: 34.14
21127740VGWEQLLTTIAR693.89 (observed)22.77E+0542.45 (HPLC [min or %B]) MS2 score: 56.14
21127740VGWEQLLTTIAR693.89 (observed)24.44E+0542.44 (HPLC [min or %B]) MS2 score: 41.29
21127740VGWEQLLTTIAR693.89 (observed)21.41E+0640.27 (HPLC [min or %B]) MS2 score: 58.6
21127740VGWEQLLTTIAR693.89 (observed)21.85E+0647.55 (HPLC [min or %B]) MS2 score: 88.78
21127740VGWEQLLTTIAR693.89 (observed)29.13E+0539.4 (HPLC [min or %B]) MS2 score: 58.6
21127740VGWEQLLTTIAR693.89 (observed)22.21E+0647.15 (HPLC [min or %B]) MS2 score: 74.87
21127740VGWEQLLTTIAR693.89 (observed)24.12E+0539.55 (HPLC [min or %B]) MS2 score: 45.96
21127740VGWEQLLTTIAR693.89 (observed)23.75E+0647.29 (HPLC [min or %B]) MS2 score: 71.35
21127740VGWEQLLTTIAR693.89 (observed)21.25E+0542.36 (HPLC [min or %B]) MS2 score: 51.6
21127740VGWEQLLTTIAR693.89 (observed)25.83E+0542.34 (HPLC [min or %B]) MS2 score: 84.58
21127740VGWEQLLTTIAR693.89 (observed)25.83E+0542.46 (HPLC [min or %B]) MS2 score: 32.03
21127740VGWEQLLTTIAR693.89 (observed)28.42E+0541.99 (HPLC [min or %B]) MS2 score: 84.07
21127740VGWEQLLTTIAR693.89 (observed)26.18E+0547.29 (HPLC [min or %B]) MS2 score: 76.91
21127740VGWEQLLTTIAR693.89 (observed)25.51E+0542.94 (HPLC [min or %B]) MS2 score: 40.46
21127740VGWEQLLTTIAR693.89 (observed)23.51E+0542.58 (HPLC [min or %B]) MS2 score: 45.4
21127740VGWEQLLTTIAR693.89 (observed)22.19E+0642.42 (HPLC [min or %B]) MS2 score: 71.83
21127740VGWEQLLTTIAR693.89 (observed)26.74E+0542.78 (HPLC [min or %B]) MS2 score: 85.1
21127740VGWEQLLTTIAR693.89 (observed)27.83E+0542.53 (HPLC [min or %B]) MS2 score: 67.55
21127740VGWEQLLTTIAR693.89 (observed)25.92E+0543.15 (HPLC [min or %B]) MS2 score: 67.65
21127740VGWEQLLTTIAR693.89 (observed)22.79E+0538.83 (HPLC [min or %B]) MS2 score: 71.27
21127740VGWEQLLTTIAR693.89 (observed)24.32E+0538.99 (HPLC [min or %B]) MS2 score: 71.25
21127740VGWEQLLTTIAR693.89 (observed)24.11E+0538.8 (HPLC [min or %B]) MS2 score: 70.83
21127740AGTQIENIDEDFR754.35 (observed)21.36E+0626.49 (HPLC [min or %B]) MS2 score: 30.87
21127740DGLAFNALIHR409.56 (observed)32.14E+0628.53 (HPLC [min or %B]) MS2 score: 32.32
21127740DGLAFNALIHR409.56 (observed)33.12E+0528.84 (HPLC [min or %B]) MS2 score: 24.4
21127740DGLAFNALIHR409.56 (observed)32.93E+0633.59 (HPLC [min or %B]) MS2 score: 26.53
21127740DLLLDPAWEK600.32 (observed)21.31E+0632.46 (HPLC [min or %B]) MS2 score: 27.66
21127740DLLLDPAWEK600.32 (observed)22.84E+0632.84 (HPLC [min or %B]) MS2 score: 37.51
21127740EGLLLWCQR587.81 (observed)23.76E+0631.97 (HPLC [min or %B]) MS2 score: 31.94
21127740FAIQDISVEETSAK769.39 (observed)28.68E+0527.65 (HPLC [min or %B]) MS2 score: 66.4
21127740GYEEWLLNEIR711.36 (observed)23.11E+0633.94 (HPLC [min or %B]) MS2 score: 34.78
21127740GYEEWLLNEIR711.36 (observed)21.32E+0634.48 (HPLC [min or %B]) MS2 score: 41.93
21127740GYEEWLLNEIR711.36 (observed)21.79E+0634.86 (HPLC [min or %B]) MS2 score: 34.7
21127740GYEEWLLNEIR711.36 (observed)21.37E+0638.15 (HPLC [min or %B]) MS2 score: 34.34
21127740GYEEWLLNEIR711.36 (observed)22.87E+0637.47 (HPLC [min or %B]) MS2 score: 53.8
21127740ICDQWDALGSLTHSR586.95 (observed)31.02E+0629.54 (HPLC [min or %B]) MS2 score: 40.54
UNPUBLISHED_1K.AGTQIENIDEDFR.D    MS2 score: 2   
UNPUBLISHED_1K.ALDFIASK.G    MS2 score: 4   
UNPUBLISHED_1K.EAMLK.H    MS2 score: 3   
UNPUBLISHED_1K.LASDLLEWIR.R    MS2 score: 10   
UNPUBLISHED_1K.NFITAEELR.R    MS2 score: 3   
UNPUBLISHED_1K.RDHALLEEQSK.Q    MS2 score: 0   
UNPUBLISHED_1K.SFSTALYGESDL.-    MS2 score: 6   
UNPUBLISHED_1K.VLAGDK.N    MS2 score: 4   
UNPUBLISHED_1K.VQQLVPK.R    MS2 score: 0   
21127740KDDPVTNLNNAFEVAEK635.32 (observed)35.00E+0527.76 (HPLC [min or %B]) MS2 score: 29.64
21127740LASDLLEWIR608.34 (observed)23.64E+0535.19 (HPLC [min or %B]) MS2 score: 78.49
21127740LASDLLEWIR608.34 (observed)28.59E+0539.54 (HPLC [min or %B]) MS2 score: 69.56
21127740LASDLLEWIR608.34 (observed)21.49E+0539.19 (HPLC [min or %B]) MS2 score: 58.54
21127740LASDLLEWIR608.34 (observed)21.11E+0639.36 (HPLC [min or %B]) MS2 score: 44.68
21127740LMLLLEVISGER694.89 (observed)21.10E+0544.96 (HPLC [min or %B])Oxidation (M)MS2 score: 53.42
21127740LMLLLEVISGER694.9 (observed)21.58E+0639.18 (HPLC [min or %B])Oxidation (M)MS2 score: 64.51
21127740LMLLLEVISGER694.89 (observed)21.12E+0545.08 (HPLC [min or %B])Oxidation (M)MS2 score: 41.83
21127740LMLLLEVISGER686.9 (observed)24.02E+0541.04 (HPLC [min or %B]) MS2 score: 52.89
21127740LMLLLEVISGER686.9 (observed)22.62E+0541.41 (HPLC [min or %B]) MS2 score: 40.2
21127740LMLLLEVISGER686.9 (observed)25.96E+0540.96 (HPLC [min or %B]) MS2 score: 45.22
21127740MTLGMIWTIILR740.41 (observed)22.02E+0544.3 (HPLC [min or %B])2 Oxidation (M)MS2 score: 28.68
21127740MTLGMIWTIILR740.41 (observed)23.06E+0543.15 (HPLC [min or %B])2 Oxidation (M)MS2 score: 36.42
21127740NFITAEELR546.79 (observed)28.99E+0521.49 (HPLC [min or %B]) MS2 score: 32.47
21127740QLEAIDQLHLEYAK827.43 (observed)21.64E+0631.81 (HPLC [min or %B])Pyro-glu (N-term Q)MS2 score: 59.39
UNPUBLISHED_1R.DGLKLMLLLEVISGER.L    MS2 score: 2   
UNPUBLISHED_1R.DLLLDPAWEK.Q    MS2 score: 5   
UNPUBLISHED_1R.EREAILAIHK.E    MS2 score: 5   
UNPUBLISHED_1R.ETTDTDTADQVIASFK.V    MS2 score: 2   
UNPUBLISHED_1R.ETTDTDTADQVIASFK.V    MS2 score: 0   
UNPUBLISHED_1R.ETTDTDTADQVIASFK.V    MS2 score: 4   
UNPUBLISHED_1R.FAIQDISVEETSAK.E    MS2 score: 35   
UNPUBLISHED_1R.FAIQDISVEETSAK.E    MS2 score: 38   
UNPUBLISHED_1R.QFASQANVVGPWIQTKMEEIGR.I    MS2 score: 0   
UNPUBLISHED_1R.TINEVENQILTR.D    MS2 score: 21   
UNPUBLISHED_1R.TINEVENQILTR.D    MS2 score: 25   
UNPUBLISHED_1R.TIPWLEDR.V    MS2 score: 0   
UNPUBLISHED_1R.VGWEQLLTTIAR.T    MS2 score: 24   
UNPUBLISHED_1R.VGWEQLLTTIAR.T    MS2 score: 33   
21127740VEQIAAIAQELNELDYYDSHNVNTR969.47 (observed)31.44E+0535.87 (HPLC [min or %B])Deamidation (NQ)MS2 score: 44.81
21127740VEQIAAIAQELNELDYYDSHNVNTR969.47 (observed)34.16E+0643.64 (HPLC [min or %B])Deamidation (NQ)MS2 score: 105.47
21127740VGWEQLLTTIAR693.89 (observed)22.53E+0547.32 (HPLC [min or %B]) MS2 score: 70.52
21127740VGWEQLLTTIAR693.89 (observed)27.93E+0546.97 (HPLC [min or %B]) MS2 score: 71.47
21127740VGWEQLLTTIAR693.89 (observed)28.26E+0538.45 (HPLC [min or %B]) MS2 score: 77.08
21127740VGWEQLLTTIAR693.89 (observed)27.78E+0442.78 (HPLC [min or %B]) MS2 score: 60.32
21127740VGWEQLLTTIAR693.89 (observed)21.01E+0642.08 (HPLC [min or %B]) MS2 score: 42.13
21127740VGWEQLLTTIAR693.89 (observed)22.34E+0542.08 (HPLC [min or %B]) MS2 score: 66.65
23308193AGTQIENIDEDFRDGLK     MS2 score: 1015.0peptide count: 11
23308193DDPVTNLNNAFEVAEK     MS2 score: 1015.0peptide count: 11
23308193DGLAFNALIHR     MS2 score: 1015.0peptide count: 11
23308193DLLLDPAWEK     MS2 score: 1015.0peptide count: 11
23308193EAILAIHK     MS2 score: 1015.0peptide count: 11
23308193ETTDTDTADQVIASFK     MS2 score: 1015.0peptide count: 11
23308193GISQEQMQEFR     MS2 score: 1015.0peptide count: 11
23376485GISQEQMQEFR676.816 (observed)   ::::::::::::
23376485GYEEWLLNEIR711.359 (observed)   ::::::::::::
23308193HEAFESDLAAHQDR     MS2 score: 1015.0peptide count: 11
23376485HRDYETATLSDIK516.93 (observed)   ::::::::::::::
23376485HRDYETATLSDIK516.934 (observed)   ::::::::::::::
23376485HRDYETATLSDIK516.928 (observed)   ::::::::::::::
23376485ICDQWDALGSLTHSR586.949 (observed)   ::Cys_CAM::::::::::::::
23308193LASDLLEWIR     MS2 score: 1015.0peptide count: 11
23376485LASDLLEWIR608.343 (observed)   :::::::::::
23376485LMLLLEVISGER686.9 (observed)   :::::::::::::
23308193VGWEQLLTTIAR     MS2 score: 1015.0peptide count: 11
23376485VGWEQLLTTIAR693.892 (observed)   :::::::::::::
23376485VGWEQLLTTIAR693.892 (observed)   :::::::::::::
23376485VGWEQLLTTIAR693.896 (observed)   :::::::::::::
23376485VGWEQLLTTIAR693.893 (observed)   :::::::::::::
23308193VLAGDKNFITAEELR     MS2 score: 1015.0peptide count: 11

Compile date 12-23-2014© PADB initiative