PADB-logoLSSR - PepMap molecular information by molecule

Molecule reference

A2341ACTN1Alpha-actinin 1

Study IDSequenceMassCharge ZIntensityElution timePost-translational modificationsScoresCountsID and experiment reference
16709260ALDFIASK-1.806073833 (delta mass [ppm])1   MS2 score: 35 
16709260ATLPDADKER0.717770868 (delta mass [ppm])2   MS2 score: 55 
16709260GISQEQMNEFR-1.001044145 (delta mass [ppm])2   MS2 score: 52 
16948836GISQEQMNEFR2 (delta mass [ppm])2    
16709260GYEEWLLNEIR0.473006728 (delta mass [ppm])2   MS2 score: 29 
16948836IIAATIENAQPILQIDNAR0.1 (delta mass [ppm])2    
16901338ILAGDKNYITMDELRR-1.84 (delta mass [ppm])3   MS2 score: 20 
15020595K.AGTQIENIEEDFR.D       
15020595K.DDPLTNLNTAFDVAER.Y       
15020595K.GISQEQMNEFR.A       
15020595K.GYEEWLLNEIR.R       
15020595K.IDQLEGDHQLIQEALIFDNK.H       
15020595K.M#LDAEDIVGTARPDEK.A       
15020595K.VLAVNQENEQLM#EDYEK.L       
16446289KGYEEWLLNEIRR 2   peptide count: 3
16446289KLASDLLEWIRR 2   peptide count: 7
18501002KLASDLLEWIRR 2    
16901338KQFGAQANVIGPWIQTK0.78 (delta mass [ppm])3   MS2 score: 24 
16901338LAILGIHNEVSK0.33 (delta mass [ppm])2   MS2 score: 35 
16901338LAILGIHNEVSK2   MS2 score: 44 
16709260LAILGIHNEVSK1.236902713 (delta mass [ppm])2   MS2 score: 53 
16709260LASDLLEWIR0.363062804 (delta mass [ppm])2   MS2 score: 68 
16948836LASDLLEWIR1.3 (delta mass [ppm])2    
16901338LLETIDQLYLEYAK2.59 (delta mass [ppm])2   MS2 score: 67 
16901338LLETIDQLYLEYAK2   MS2 score: 78 
16948836LLETIDQLYLEYAK0.4 (delta mass [ppm])2    
16901338LVSIGAEEIVDGNVK2   MS2 score: 62 
16901338QKDYETATLSEIK2   MS2 score: 77 
15020595R.ETADTDTADQVM#ASFK.I       
15020595R.FAIQDISVEETSAK.E       
15020595R.KDDPLTNLNTAFDVAER.Y       
15020595R.LAILGIHNEVSK.I       
15020595R.TINEVENQILTR.D       
15020595R.VGWEQLLTTIAR.T       
16901338RDQALTEEHAR3   MS2 score: 21 
16709260RDQALTEEHAR0.379723424 (delta mass [ppm])3   MS2 score: 63 
18501002RETADTDTADQVM*ASFKI 2    
16446289RKDDPLTNLNTAFDVAEKY 2   peptide count: 1
18501002RLSNRPAFM*PSEGRM 3    
18501002RLSNRPAFMPSEGRM 2    
18501002RTINEVENQILTRD 2    
16446289RVGWEQLLTTIART 2   peptide count: 9
18501002RVGWEQLLTTIART 2    
16709260TINEVENQILTR-0.496235469 (delta mass [ppm])2   MS2 score: 59 
16709260VGWEQLLTTIAR0.17246771 (delta mass [ppm])2   MS2 score: 74 
16948836VGWEQLLTTIAR1.9 (delta mass [ppm])2    
16709260VLAVNQENEQLMEDYEK1.716276433 (delta mass [ppm])2   MS2 score: 48 
16948836YCMQLSQIQGLIGSVEEQLAQLR2.2 (delta mass [ppm])3    
16684767KAGTQIENIEEDFRDGLKL 2    
16684767KAGTQIENIEEDFRDGLKLMLLLEVISGERL 3    
16684767KAIMTYVSSFYHAFSGAQKA 2    
16684767KALDFIASKG 2    
16684767KASIHEAWTDGKE 2    
16684767KASIHEAWTDGKEAMLRQ 2    
16684767KCQLEINFNTLQTKL 2    
16684767KDDPLTNLNTAFDVAEKY 2    
16684767KDGLGFCALIHRH 2    
16684767KEGLLLWCQRK 2    
16684767KEGLLLWCQRKT 2    
16684767KGISQEQMNEFRA 2    
16684767KGYEEWLLNEIRR 2    
16684767KHTNYTM*EHIRV 2    
16684767KHTNYTMEHIRV 2    
16684767KICDQWDNLGALTQKR 2    
16684767KIDQLEGDHQLIQEALIFDNKH 2    
16684767KILAGDKNYITMDELRR 2    
16684767KILAGDKNYITMDELRRE 2    
16684767KIVQTYHVNMAGTNPYTTITPQEINGKW 3    
16684767KIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQ 3    
16684767KKHEAFESDLAAHQDRV 2    
16684767KKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARC 3    
16684767KLASDLLEWIRR 1    
16684767KLLETIDQLYLEYAKR 2    
16684767KLLETIDQLYLEYAKRA 2    
16684767KLRKDDPLTNLNTAFDVAEKY 2    
16684767KLRKDDPLTNLNTAFDVAEKYLDIPKM 3    
16684767KLVSIGAEEIVDGNVKM 2    
16684767KMLDAEDIVGTARPDEKA 2    
16684767KNVNIQNFHISWKD 2    
16684767KQFGAQANVIGPWIQTKM 2    
16684767KSIVNYKPKI 2    
16684767KTFTAWCNSHLRK 2    
16684767KVLAVNQENEQLM*EDYEKL 2    
16684767KVLAVNQENEQLMEDYEKL 2    
16684767KVLAVNQENEQLMEDYEKLASDLLEWIRRT 3    
16684767RAAPFNNWM*EGAMEDLQDTFIVHTIEEIQGLTTAHEQFKA 3    
16684767RASFNHFDRD 2    
16684767RELPPDQAEYCIARM 2    
16684767RETADTDTADQVM*ASFKI 2    
16684767RETADTDTADQVMASFKI 2    
16684767RFAIQDISVEETSAKE 2    
16684767RHRPELIDYGKL 2    
16684767RISIEM*HGTLEDQLSHLRQ 3    
16684767RISIEMHGTLEDQLSHLRQ 2    
16684767RKAGTQIENIEEDFRDGLKL 2    
16684767RKDDPLTNLNTAFDVAEKY 2    
16684767RKQFGAQANVIGPWIQTKM 2    
16684767RLAILGIHNEVSKI 2    
16684767RLDHLAEKF 1    
16684767RLSNRPAFMPSEGRM 2    
16684767RMVSDINNAWGCLEQVEKG 2    
16684767RQKDYETATLSEIKA 2    
16684767RRDQALTEEHARQ 2    
16684767RTINEVENQILTRD 2    
16684767RVEQIAAIAQELNELDYYDSPSVNARC 3    
16684767RVGWEQLLTTIART 2    
16684767RVPENTMHAMQQKL 2    
18361515K.ASIHEAWTDGK.E607.97 (observed)2    
18361515K.ASIHEAWTDGK.E607.54 (observed)2    
18361515K.DYETATLSEIK.A635.45 (observed)2    
18361515K.GYEEWLLNEIR.R711.55 (observed)2    
18361515K.KHEAFESDLAAHQDR.V877.17 (observed)2    
18361515K.LASDLLEWIR.R608.34 (observed)2    
18361515K.SIVNYKPK.I474.63 (observed)2    
18361515K.TFTAWCNSHLR.K697.3 (observed)2    
18361515R.HRPELIDYGK.L614.34 (observed)2    
18361515R.LAILGIHNEVSK.I647.41 (observed)2    
18361515R.TINEVENQILTR.D715.33 (observed)2    
18361515R.VGWEQLLTTIAR.T693.39 (observed)2    
18361515R.VGWEQLLTTIAR.T693.72 (observed)2    
18614015(-)MEELGR(V)      peptide count: 1
18614015(K)AGTQIENIEEDFR(N)      peptide count: 1
18614015(K)AIMTYVSSFYHAFSGAQK(A)      peptide count: 2
18614015(K)ALDFIASK(G)      peptide count: 1
18614015(K)ASIHEAWTDGK(E)      peptide count: 1
18614015(K)ATLPDADKER(L)      peptide count: 6
18614015(K)CQLEINFNTLQTK(L)      peptide count: 1
18614015(K)EGLLLWCQR(K)      peptide count: 3
18614015(K)EGLLLWCQRK(T)      peptide count: 1
18614015(K)GISQEQMNEFR(A)      peptide count: 5
18614015(K)GYEEWLLNEIR(R)      peptide count: 9
18614015(K)ICDQWDNLGALTQK(R)      peptide count: 1
18614015(K)IDQLECDHQLIQEALIFDNK(H)      peptide count: 1
18614015(K)ISNVNK(A)      peptide count: 2
18614015(K)LLETIDQLYLEYAK(R)      peptide count: 9
18614015(K)LMLLLEVISGER(L)      peptide count: 6
18614015(K)TFTAWCNSHLR(K)      peptide count: 1
18614015(K)VLAVNQENEQLMEDYEK(L)      peptide count: 1
18614015(R)DLLLDPAWEK(Q)      peptide count: 1
18614015(R)EALERTEK(L)      peptide count: 1
18614015(R)FAIQDISVEETSAK(E)      peptide count: 4
18614015(R)FLDIPK(M)      peptide count: 2
18614015(R)HRPELIDYGK(L)      peptide count: 3
18614015(R)KHEAFESDLAAHQDR(V)      peptide count: 3
18614015(R)LAILGIHNEVSK(I)      peptide count: 2
18614015(R)LASDLLEWIR(R)      peptide count: 20
18614015(R)LDHLAEK(F)      peptide count: 25
18614015(R)LSNRPAFMPSEGR(M)      peptide count: 1
18614015(R)RDQALTEEHAR(Q)      peptide count: 10
18614015(R)TINEVENQILTR(D)      peptide count: 5
18614015(R)VGWEQLLTTIAR(T)      peptide count: 18
18578523AGTQIENIEEDFRDGLK2   
18578523AGTQIENIEEDFRDGLK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK2   
18578523AIMTYVSSFYHAFSGAQK3   
21616181ALDFIASK1152.67937 (observed)   N-Term(iTRAQ4plex), K8(iTRAQ4plex)peptide count: 3
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK2   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASFNHFDRDHSGTLGPEEFK3   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
18578523ASIHEAWTDGK2   
21616181CQLEINFNTLQTK1885.9782 (observed)   N-Term(iTRAQ4plex), C1(Methylthio), K13(iTRAQ4plex)peptide count: 7
21616181CQLEINFNTLQTK1885.97513 (observed)   N-Term(iTRAQ4plex), C1(Methylthio), K13(iTRAQ4plex)peptide count: 4
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523CQLEINFNTLQTK2   
18578523DGLGFCALIHR2   
21616181DLLLDPAWEK1487.84197 (observed)   N-Term(iTRAQ4plex), K10(iTRAQ4plex)peptide count: 6
21616181DLLLDPAWEK1487.83684 (observed)   N-Term(iTRAQ4plex), K10(iTRAQ4plex) peptide count: 2
21616181EGLLLWCQR1307.67766 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 20
21616181EGLLLWCQR1307.67497 (observed)   N-Term(iTRAQ4plex), C7(Methylthio)peptide count: 18
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
18578523EGLLLWCQR2   
21616181ELPPDQAEYCIAR1694.80254 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 85
21616181ELPPDQAEYCIAR1694.8012 (observed)   N-Term(iTRAQ4plex), C10(Methylthio)peptide count: 94
21616181ETADTDTADQVMASFK2017.97293 (observed)   N-Term(iTRAQ4plex), K16(iTRAQ4plex)peptide count: 2
21616181FAIQDISVEETSAK1825.98625 (observed)   N-Term(iTRAQ4plex), K14(iTRAQ4plex)peptide count: 17
21616181FAIQDISVEETSAK1825.9876 (observed)   N-Term(iTRAQ4plex), K14(iTRAQ4plex)peptide count: 14
21616181GISQEQMNEFR1482.71526 (observed)   N-Term(iTRAQ4plex)peptide count: 3
21616181GISQEQMNEFR1482.71257 (observed)   N-Term(iTRAQ4plex)peptide count: 4
21616181GYEEWLLNEIR1565.81194 (observed)   N-Term(iTRAQ4plex)peptide count: 14
21616181GYEEWLLNEIR1565.81438 (observed)   N-Term(iTRAQ4plex)peptide count: 23
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523GYEEWLLNEIR2   
18578523HEAFESDLAAHQDR2   
18578523HEAFESDLAAHQDR2   
18578523HRPELIDYGK2   
18578523HRPELIDYGK2   
18578523HRPELIDYGK2   
18578523HRPELIDYGK2   
18578523HRPELIDYGK2   
18578523HRPELIDYGK2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523HTNYTMEHIR2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523ICDQWDNLGALTQK2   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK2   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523IDQLEGDHQLIQEALIFDNK3   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR3   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR3   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR2   
18578523ISIEMHGTLEDQLSHLR2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KDDPLTNLNTAFDVAEK2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR3   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KHEAFESDLAAHQDR2   
18578523KTFTAWCNSHLR2   
18578523KTFTAWCNSHLR3   
18578523KTFTAWCNSHLR2   
18578523KTFTAWCNSHLR3   
18578523LAILGIHNEVSK2   
18578523LAILGIHNEVSK2   
18578523LAILGIHNEVSK2   
18578523LAILGIHNEVSK2   
18578523LAILGIHNEVSK2   
18578523LAILGIHNEVSK2   
18578523LASDLLEWIR2   
18578523LASDLLEWIR2   
18578523LASDLLEWIR2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
18578523LLETIDQLYLEYAK2   
21616181LMLLLEVISGER1532.88713 (observed)   N-Term(iTRAQ4plex), M2(Oxidation)peptide count: 2
18578523LMLLLEVISGER2   
18578523LMLLLEVISGER2   
18578523LMLLLEVISGER2   
18578523LMLLLEVISGER2   
18578523LMLLLEVISGER2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MLDAEDIVGTARPDEK2   
18578523MVSDINNAWGCLEQVEK2   
18578523MVSDINNAWGCLEQVEK2   
18578523NVNIQNFHISWK2   
18578523NVNIQNFHISWK2   
18578523NVNIQNFHISWK2   
18578523NVNIQNFHISWK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QFGAQANVIGPWIQTK2   
18578523QKDYETATLSEIK2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
18578523TFTAWCNSHLR2   
21616181TINEVENQILTR1573.86943 (observed)   N-Term(iTRAQ4plex)peptide count: 50
21616181TINEVENQILTR1573.86809 (observed)   N-Term(iTRAQ4plex)peptide count: 65
18578523TINEVENQILTR2   
18578523TINEVENQILTR2   
18578523VEQIAAIAQELNELDYYDSPSVNAR3   
18578523VEQIAAIAQELNELDYYDSPSVNAR3   
21616181VGWEQLLTTIAR1530.88249 (observed)   N-Term(iTRAQ4plex)peptide count: 38
21616181VGWEQLLTTIAR1530.88042 (observed)   N-Term(iTRAQ4plex)peptide count: 31
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
18578523VGWEQLLTTIAR2   
UNPUBLISHED_1K.ALDFIASK.G    MS2 score: 14   
UNPUBLISHED_1K.ALDFIASK.G    MS2 score: 4   
UNPUBLISHED_1K.ATLPDADKER.L    MS2 score: 1   
UNPUBLISHED_1K.ATLPDADKER.L    MS2 score: 4   
UNPUBLISHED_1K.ILAGDK.N    MS2 score: 11   
UNPUBLISHED_1K.LASDLLEWIR.R    MS2 score: 10   
UNPUBLISHED_1K.LEDFR.D    MS2 score: 7   
UNPUBLISHED_1R.CQKICDQWDNLGALTQK.R    MS2 score: 2   
UNPUBLISHED_1R.DGLKLMLLLEVISGER.L    MS2 score: 2   
UNPUBLISHED_1R.DLLLDPAWEK.Q    MS2 score: 12   
UNPUBLISHED_1R.DLLLDPAWEK.Q    MS2 score: 5   
UNPUBLISHED_1R.FAIQDISVEETSAK.E    MS2 score: 27   
UNPUBLISHED_1R.FAIQDISVEETSAK.E    MS2 score: 35   
UNPUBLISHED_1R.FAIQDISVEETSAK.E    MS2 score: 38   
UNPUBLISHED_1R.KAGTQIENIEEDFR.D    MS2 score: 2   
UNPUBLISHED_1R.KTAPYK.N    MS2 score: 4   
UNPUBLISHED_1R.LSNRPAFMPSEGR.M    MS2 score: 10   
UNPUBLISHED_1R.LSNRPAFMPSEGR.M    MS2 score: 1   
UNPUBLISHED_1R.QYEKSIVNYKPK.I    MS2 score: 18   
UNPUBLISHED_1R.TINEVENQILTR.D    MS2 score: 21   
UNPUBLISHED_1R.VGWEQLLTTIAR.T    MS2 score: 24   
UNPUBLISHED_1R.VGWEQLLTTIAR.T    MS2 score: 6   
UNPUBLISHED_1R.VGWEQLLTTIAR.T    MS2 score: 33   
23308193AIMTYVSSFYHAFSGAQK     MS2 score: 847.00peptide count: 15
23308193DLLLDPAWEK     MS2 score: 847.00peptide count: 15
23308193DYETATLSEIK     MS2 score: 847.00peptide count: 15
23308193GISQEQMNEFR     MS2 score: 847.00peptide count: 15
23308193HEAFESDLAAHQDR     MS2 score: 847.00peptide count: 15
23308193IDQLEGDHQLIQEALIFDNK     MS2 score: 847.00peptide count: 15
23308193KQFGAQANVIGPWIQTK     MS2 score: 847.00peptide count: 15
23308193LASDLLEWIR     MS2 score: 847.00peptide count: 15
23308193LSNRPAFMPSEGR     MS2 score: 847.00peptide count: 15
23308193MLDAEDIVGTARPDEK     MS2 score: 847.00peptide count: 15
23308193NVNIQNFHISWK     MS2 score: 847.00peptide count: 15
23308193QFGAQANVIGPWIQTK     MS2 score: 847.00peptide count: 15
23308193TINEVENQILTR     MS2 score: 847.00peptide count: 15
23308193VGWEQLLTTIAR     MS2 score: 847.00peptide count: 15
23308193VLAVNQENEQLMEDYEK     MS2 score: 847.00peptide count: 15

Compile date 12-23-2014© PADB initiative